(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE379

PENCW_16.PE379       Location/Qualifiers
FT   CDS_pept        join(complement(871291..871309),complement(869626..871178),
FT                   complement(868750..869577))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000195804" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19824643"
FT                   /orf_name="Pc20g03790"
FT                   /product="Pc20g03790 protein"
FT                   /protein_id="CAP85708.1"
FT                   /db_xref="InterPro:IPR011044"
FT                   /db_xref="InterPro:IPR013863"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="UniParc:UPI00018312D8"
FT                   /db_xref="UniProtKB/TrEMBL:B6HGU2"
FT                   /transl_table=1
FT                   /translation="MFMLRNVSKFLFGDASKESIIEIPQGELYLVRPQSPKGYSELIFK
FT                   DAAATIRRTGQDFQYQLVIQRAYEEGEEELADDDGEQGAGDGLDKDEKVFLLDQTLHFR
FT                   SEVRDGGAKILAWDDLSGDAGDLFEFICDSSVPSDKVATFELAALQCQYERKHRRSAQK
FT                   ATEAELEEFSYNEEKPIPSASPVSSPTRNSLTAEDSAAAMAKDVEYAQSKGKVKTATLE
FT                   EEPTTAPPSAAHPEAKEILCKENAELHLFDFSTGTFVLQESDIVATVSEVGTWQYWLQI
FT                   SGKDKEWLGQAVVADINPVFNFEYLSFIFNHYGEDGSAYSWLLRFKDQASEERFQEGLM
FT                   QALWEQLNEVKWTKVKENDRDYVLDAFQDLTMEDADEPQEEVEEEEEETYDGDQDDAQR
FT                   SEHYDSDEEEEDVVTRDADGNVNSQLAVGYKHDRSFVVRGSKIGVFKHTAHNNLEFSTT
FT                   ISKVETPKGNLFSPKKVMLHAEDQNMILQNGDDPNSLYKMDLEYGKIVDEWKVHDDIPV
FT                   ETFAPENNSQKFAQMTAAQPFVGVSKNALYRIDPRLSGNKLVDSDLKQYASKNDFSAMA
FT                   TTEKGYLAVASNKGDIRMFDRLGINAKTHIPALGEPIIGLDVSADGRWVLATCRTYLLL
FT                   IDSLQKEGKNEGKLGFERAFAKDSKPQPRRLGLQPAHVAQFQHETKQPLSFTTARFNTG
FT                   IDSTETSIVTSTGPFIITWSMKKVIANRKDPYTIKRYGENVMADNFRFGSDKNVIVALP
FT                   NEVNMVAKRTFQKPTRESIAGPATPKRARSGWSSRLGKDDIVNSPY"
     atgtttatgc tccgcaacgt gagcaaattc ttgttcggtg acgcttcgaa agaatccatc        60
     atcgaaatcc cccaaggcga gctgtatctg gtccgcccac aatcgcccaa aggttactct       120
     gagcttatct tcaaggacgc tgctgccacg atccgacgca ccggccagga ctttcaatac       180
     cagcttgtaa tccagagagc ctatgaagag ggcgaggaag aactcgcgga cgacgacggc       240
     gagcaaggcg cgggcgacgg cctagataag gacgagaagg ttttccttct ggaccaaacc       300
     ctccactttc ggtctgaagt tcgcgacgga ggcgcaaaga tattggcttg ggatgatctg       360
     agtggtgacg ctggtgatct ctttgaattc atctgtgatt cttcggtccc atcggacaaa       420
     gtcgccactt tcgagcttgc cgccctccag tgtcagtacg aacgcaaaca ccgccgcagc       480
     gcgcagaagg ctaccgaggc ggagttggag gagttctcat acaacgaaga gaagcccatt       540
     ccatctgcga gtccggtctc ttcgccgact agaaattcct tgacagcaga agactcagct       600
     gcagccatgg caaaagacgt ggaatatgct caatccaaag gaaaagtcaa gactgccact       660
     ctcgaggagg aaccgactac tgccccgccg tctgcggccc atcccgaagc caaagagatc       720
     ctctgcaagg aaaatgccga gctgcacttg ttcgactttt ccaccggaac ctttgtgctc       780
     caggagtcgg acatcgttgc tactgtctcg gaggtcggta cttggcagta ctggctccag       840
     atttctggca aggacaagga gtggttagga caggccgttg tggccgacat taatcccgta       900
     ttcaacttcg aatatctttc ctttatcttc aaccactacg gtgaggatgg ttcggcctac       960
     tcatggctcc tgcgattcaa ggaccaagcc tcggaagaac gtttccagga gggtctcatg      1020
     caggcgttat gggaacagct caatgaggtg aagtggacta aggtcaagga gaatgaccga      1080
     gattatgtcc ttgatgcctt ccaagatctt accatggagg atgccgacga accccaagaa      1140
     gaagttgaag aagaagagga agagacatac gatggcgacc aggacgatgc tcagcgcagt      1200
     gagcactacg acagcgatga ggaggaagaa gatgttgtca cgcgcgatgc cgatggcaac      1260
     gtcaactcgc aattggcagt cggttacaag catgatcgat cattcgttgt gcgcggatcc      1320
     aagattggtg tcttcaagca caccgctcac aacaaccttg aattctccac gactatttca      1380
     aaagttgaga cccccaaggg caaccttttc agccccaaga aggtcatgct ccatgctgag      1440
     gatcagaaca tgattctcca gaatggggac gatcccaatt cgctgtacaa gatggatctg      1500
     gagtacggca aaatcgtcga cgaatggaaa gtccatgacg atattcccgt ggagacgttt      1560
     gctcccgaaa acaactcgca gaaattcgcg caaatgaccg ccgcgcagcc attcgttgga      1620
     gtctcgaaga acgcccttta ccgcatcgat cctcgtcttt ctggaaacaa gcttgtcgat      1680
     tccgatctga agcagtacgc cagcaagaat gacttctcgg ctatggctac tactgagaag      1740
     ggataccttg ctgtcgcgtc caacaagggt gacatccgca tgttcgaccg tcttggcatc      1800
     aatgcgaaga ctcatatccc ggctctcggt gagccgatca tcggtcttga tgtgtctgca      1860
     gatggacgct gggtgctggc aacttgccgt acctaccttc tcctcattga ttcccttcaa      1920
     aaagaaggga aaaacgaggg caagcttgga ttcgagcgtg ctttcgcgaa ggactcgaag      1980
     cctcagcctc gccgtcttgg cttgcagccc gcacacgttg cccagttcca gcacgagacg      2040
     aagcagcctc tctcgttcac cacggcccgc ttcaacactg gtatcgactc aacggaaacc      2100
     agcatcgtca cctctaccgg ccccttcatc attacatgga gtatgaagaa ggttattgcc      2160
     aaccgcaagg acccgtacac tatcaagcgg tatggggaaa acgtgatggc tgataatttc      2220
     cggttcggct ctgacaagaa tgtgatcgtt gctctgccaa acgaggtcaa catggtcgcc      2280
     aagcgtactt tccagaagcc tactcgtgag agtatcgctg gcccggccac accaaagcgt      2340
     gcgcgcagcg gatggagcag tcgtcttggc aaggatgaca ttgtcaactc gccttactag      2400
//

If you have problems or comments...

PBIL Back to PBIL home page