(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE382

PENCW_16.PE382       Location/Qualifiers
FT   CDS_pept        join(complement(877307..878795),complement(877128..877252),
FT                   complement(877006..877077),complement(876726..876950),
FT                   complement(876566..876669),complement(876248..876506),
FT                   complement(876048..876190),complement(875396..875991),
FT                   complement(874638..875323))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000195837" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948893"
FT                   /orf_name="Pc20g03820"
FT                   /product="Pc20g03820 protein"
FT                   /function="binding"
FT                   /protein_id="CAP85711.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR013598"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniParc:UPI00018312DB"
FT                   /db_xref="UniProtKB/TrEMBL:B6HGU5"
FT                   /transl_table=1
FT                   /translation="MAAEELSEGGMADIIRALQLIHNPASSNDIRKEASQFVENLKESD
FT                   AAARNGFLLASRMEHEPVVRYFGLTLLDHVLRQYNFTNPEEAKNLRMMILQLAENVRPE
FT                   DPAYFRNKISQLWTEAAKKTWGLDWMDMDANLVQFWGASLVHKELVLAVLETLSEDVFF
FT                   REDTASSLRGGELNRSLVEIFTPAGIVEQITGDKTTATIPRCGQEGWLVRICEFLDNCV
FT                   QNVSSSEQARDAATKALATLRSALSWSVYKGVIASQVVPSIFRALPCQDDQVLLSAVEA
FT                   LHALYGRNTIGSEDSQELVCLIFQPVYLVVLQRLYEWSIVGPDDVDEPKYLISKKLSEM
FT                   ISYIAGCLEDDKFLVSTMDRLNLPPFLQFMVNIMQHQSLTVSIPCLHLWSRLLQNSKIS
FT                   NLDFVVEQTPQFLNICTQRLLRWESLPTESEDPTVQFLVEDIDTVPERHAFVGNYRRYC
FT                   SSIIETITFKRPQEAVREILARVDTNLDNLYNGVQPFSMATFSKSSIPLMRADAQFAVV
FT                   EAVIKGYNKWISAHGKAPQRDESKRMELEHAVENWASTLMQKSFEDPVLKQRVIKLVVD
FT                   ISSKALDNHQGFALKVLEHILMSRLPDRSEYPLYSEAVKELHGLASSELRRLAMRYADY
FT                   FYTFYDLLEPKIKEITLANRIDDKLQMELTSILLIIMQRAINADPYLRQNRLASFLQPI
FT                   QEAWQDDQFRHSSSTFPGFCNMLGLENVGPYMQSKEAQKLADWSEVALDNEGRLVQEEM
FT                   TRKFQLLPLRGTKTMLAVSTDRVKKSSPAYATACQMWHELIPIILPTLLQLVRNAHAFH
FT                   NPANWNMVEGMQPVVERILTDRFWQAGISIGSRDEFYARITSSKSTLEGFASSVRGKVR
FT                   AVREACYSMLFSMSRMREHFYGFAELPGPLSEALFVDSPHLSSHQFSVLLNISRCLIDD
FT                   CPVQFRSQFLPPMLSTLFTNIDRKVTTEWEIIEQRRNGISDGDLTTEMKSESVLRQLTY
FT                   SAVIMVASLFDPQRGDPDGTESDPTAPQPTPNLSDSIRHFVLSSPQIFEPVMLFCTHAL
FT                   RMRDTRSGSIITRVIRSILQDFAPTNDTPDTPTIATIREFICTDVLTACISSVHESYFV
FT                   DMQKDLAQLIASIWCLYGFCSETPRAVFLSLPGISAEKVASTESALHQTTSPRQQRALV
FT                   LELLEPLRGISVAEQGKILGSREERRKARSALQERYMTNEMDTQQQNHRVDINDGPDLG
FT                   GVADLFG"
     atggctgcgg aggagttgtc ggagggcggc atggccgaca tcatccgtgc cctgcaactc        60
     attcacaacc ctgcatcgtc aaacgatata cggaaggagg cttcgcagtt cgtggagaat       120
     ctgaaagagt ctgacgctgc ggctcgaaat ggctttctct tggcctcccg tatggagcat       180
     gagcctgttg tacgatactt cggtcttact ctcctcgatc acgttcttcg ccaatacaac       240
     ttcaccaatc ccgaagaagc caagaattta cgcatgatga ttttgcagct cgccgagaac       300
     gttcgccccg aagaccctgc ctattttcgg aataagatct cccagttgtg gaccgaggct       360
     gctaagaaga cctgggggct ggattggatg gatatggatg ccaacctggt tcagttctgg       420
     ggtgcatctc tggttcacaa agagttggta cttgctgttc tggagactct ttccgaggat       480
     gtctttttcc gagaagatac cgcctcgtca cttcgcggag gagagctcaa tcggtcgctc       540
     gtcgagattt ttacccctgc aggcatagtg gagcagatta ctggggataa aactaccgcc       600
     accattccac gctgtggaca ggagggctgg ctcgttcgca tctgcgaatt tcttgacaac       660
     tgcgtccaga atgtctctag ctcggaacag gctcgggatg cggccacaaa agctctggca       720
     actttgagat ctgccttgtc atggtccgtc tataaaggcg ttattgcctc ccaggtcgtt       780
     cccagcattt tccgagcttt gccttgtcaa gatgaccagg tgcttctctc tgcggtcgag       840
     gcacttcatg cgctttatgg aaggaacact atcggcagtg aagactcgca ggagctagtc       900
     tgcctgatat ttcagccagt gtaccttgtt gttctccaac ggctttacga atggtcaatt       960
     gtcggcccgg acgacgtcga tgaacccaaa tatcttatct ccaaaaagct ttccgagatg      1020
     atttcatata ttgcaggatg cttggaagat gacaagttct tagtctctac catggaccgt      1080
     ttgaatctgc cgccattcct gcaattcatg gtcaacatca tgcagcacca gagcttgacg      1140
     gtctccatac cttgcttgca tctttggtcc agactgttac aaaactcaaa aatcagtaac      1200
     ctggacttcg tggtagaaca aactcctcaa tttttgaaca tctgcaccca gaggcttctt      1260
     cgttgggagt ctctcccgac tgaatccgag gatcccacgg tacagttctt agtagaggat      1320
     attgatacag tccccgaacg acatgcattt gttggaaact accgccgtta ctgttcttcg      1380
     atcatcgaaa ccatcacctt caagcggccc caagaagcgg tgcgggaaat cctggcccgg      1440
     gtggacacca acctcgacaa cttgtataac ggcgttcagc catttagcat ggcaactttc      1500
     agcaagtcgt cgattcctct catgcgagcg gatgctcaat tcgcagtggt agaggctgtc      1560
     atcaagggct acaacaagtg gatttcggcg catggaaaag caccccaacg tgatgagtct      1620
     aaacgaatgg aattagaaca tgcggtggaa aactgggctt caactctaat gcaaaagtcc      1680
     ttcgaggatc cggttttgaa acaaagggtc atcaaattag ttgtcgacat ctcctcaaag      1740
     gccttggaca atcatcaagg atttgcactc aaagttctgg agcacattct catgtcacgt      1800
     ctaccagatc ggtctgaata cccattgtat tccgaggctg tcaaggaact tcatggactg      1860
     gcaagctccg aacttcgtcg gttagctatg cgttatgccg attacttcta tactttctat      1920
     gatcttcttg agccaaagat caaagagatc acactggcta accgcatcga tgacaagttg      1980
     caaatggaac tgacttctat cttgctcatt attatgcaac gtgcaatcaa tgcagaccct      2040
     tatctgcgtc aaaatcggct cgcatcattc cttcaaccca tccaagaggc gtggcaagat      2100
     gaccaattcc gtcacagcag ctccactttc cccggttttt gcaatatgct cggattggaa      2160
     aatgttggtc catacatgca atccaaagaa gcacagaaac tggcagactg gtctgaggtt      2220
     gccttggaca acgaaggaag gttagtccag gaagagatga ccagaaagtt ccagctattg      2280
     ccattgcgtg gcaccaaaac tatgttggct gtttctacag accgagtcaa aaagtcctcg      2340
     ccagcctatg cgaccgcctg tcagatgtgg cacgaattga tccctatcat tcttcccact      2400
     ttgctgcagc ttgtcagaaa cgcgcatgcc ttccataacc ctgccaattg gaacatggtc      2460
     gaaggaatgc aaccagtagt cgaacgtatc ctcacggatc gattttggca ggctggtatt      2520
     tctatcggca gccgagatga gttctatgcc agaatcacat cgtcgaagtc tacacttgaa      2580
     gggtttgcat catcagtccg aggaaaagtc agagctgtcc gcgaggcatg ttactccatg      2640
     ctattcagca tgagcaggat gcgagagcac ttttatggat tcgccgaact cccaggaccc      2700
     ctatccgaag cgttattcgt tgactcaccg catctctcct cccatcagtt ctcggttctc      2760
     ctcaacatct cgcgttgtct gattgacgac tgccctgtgc agttccgcag ccaattcttg      2820
     ccccccatgt tgtcaactct attcaccaac attgaccgca aagtcaccac agaatgggaa      2880
     atcattgaac aacgcaggaa cggaatttcg gatggagatc tcacgacgga gatgaagtcc      2940
     gaaagtgtcc ttcgccagtt gacttactct gctgtgatca tggtagccag tctattcgat      3000
     ccgcagagag gtgacccaga tgggactgaa tcggacccca ccgcacccca gccgactccg      3060
     aacctctctg attctatccg ccattttgtc ctttcgtccc cccaaatctt tgagccagtc      3120
     atgcttttct gtacgcacgc tcttcgtatg cgcgatacac gcagcggcag cattatcact      3180
     cgcgtaattc ggtcaattct gcaagacttc gcccccacga atgatacccc ggacacccca      3240
     accatcgcga ccatccgcga attcatatgt actgatgtcc tcacagcatg catttcatcc      3300
     gtacatgagt catactttgt tgatatgcaa aaggaccttg cccagctaat tgcatcgatt      3360
     tggtgtctct atggcttctg tagcgagact cctcgtgctg ttttcctgag cttgccagga      3420
     attagcgcag agaaagtggc cagtactgag tctgcacttc atcaaactac ctcaccaaga      3480
     cagcagcgcg cattagtctt ggagcttctt gagcccttgc gcggcatcag tgttgccgag      3540
     caagggaaga tactaggttc tcgcgaggaa cgtcgcaagg cccgctcagc attgcaggag      3600
     agatacatga ccaatgagat ggacacccag cagcagaacc accgagtcga tattaacgat      3660
     ggtcccgatc ttggtggtgt ggctgatcta tttgggtag                             3699
//

If you have problems or comments...

PBIL Back to PBIL home page