(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE383

PENCW_16.PE383       Location/Qualifiers
FT   CDS_pept        complement(878843..879157)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19824644"
FT                   /orf_name="Pc20g03830"
FT                   /product="Putative uncharacterized protein Pc20g03830 "
FT                   /protein_id="CAP85712.1"
FT                   /db_xref="UniParc:UPI00018312DC"
FT                   /db_xref="UniProtKB/TrEMBL:B6HH53"
FT                   /transl_table=1
FT                   /translation="MGERCALVDLWGKFSARQVTNCLLQVFPFEILLRQLPSLQKYRFI
FT                   TPSPLLNLEPPSPRKERVARADGRCGVRLLNYHRTSSTAIESYLPFPDYATRPTTVIRD
FT                   "
     atgggtgagc ggtgtgccct tgttgatctt tggggaaaat tctcagcccg acaagtcacc        60
     aattgtctgc tgcaagtctt ccctttcgag atcttacttc gccaactacc ttcgttgcaa       120
     aagtaccgat tcataactcc aagtccgctc ctcaacctcg aaccaccctc cccccggaaa       180
     gagcgagtgg cgcgtgcgga tggccgttgc ggtgtccgtc tgctaaacta ccacaggacg       240
     agttcaacgg ccatcgagtc ttacctaccc ttccctgatt atgcgacgcg gcctactaca       300
     gtgatacgag actga                                                        315
//

If you have problems or comments...

PBIL Back to PBIL home page