(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE384

PENCW_16.PE384       Location/Qualifiers
FT   CDS_pept        join(complement(881595..881978),complement(880284..881534),
FT                   complement(879583..880221))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000195848" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948894"
FT                   /orf_name="Pc20g03840"
FT                   /product="Pc20g03840 protein"
FT                   /function="cation binding"
FT                   /function="hydrolase activity, hydrolyzing O-glycosyl
FT                   compounds"
FT                   /biological_process="carbohydrate metabolic process "
FT                   /protein_id="CAP85713.1"
FT                   /db_xref="GO:0004553"
FT                   /db_xref="GO:0005975"
FT                   /db_xref="GO:0043169"
FT                   /db_xref="InterPro:IPR001547"
FT                   /db_xref="InterPro:IPR013781"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniParc:UPI00018312DD"
FT                   /db_xref="UniProtKB/TrEMBL:B6HH54"
FT                   /transl_table=1
FT                   /translation="MAPLHLKVEGQTFRDPHNREITLRGINVAADAKYPKTPDVPSYIA
FT                   ENFFDADNVSFVERPFSLEDAHIHFKRLRKWGYNTIRYIFTWEAIEHAGPGVYDHEWVA
FT                   YTIEVLRIAKQYDFWVFMDPHQDVWSRLSGGSGAPMWTLYAAGLNPRTFKDTEAALVQN
FT                   TYDIPAEFPKMIWSTNYTRLVCQTMFTLFWAGRDFAPKAIIDGMNIQDYLQDHFINACA
FT                   FLARRIHEAGDLGEVIIGWESMNEPHRGLVGVQDISVIPPEQQLQLGTSPTAFQAMLTG
FT                   SGKACEQTTWAFGNFGPYKTGTNLVDPAGVIAWLPADQSFNDNQYGWQRDPGWKLGECI
FT                   WAQHGVWDPSTDVLLQKDYFSKKPTGEPLDYEKFTNSYFLDHYRAYKNAIRRIWPDAIM
FT                   FCQPPVMEVPPDIKGTTDDDPNMVHAVHFYDGLTLLTKHWNRLYNVDVIGVLRGKYLTP
FT                   AFALKVGETAIRNCLRDQLKFLRDESRNYMGSHPVVFTEIGIPYDMDDKYAYKTGDYSS
FT                   QTSAMDANHFALEGSTSNGFTLWVYVTQNDHEWGDQWNGEDLSIYSRDDLDLPAGSSTR
FT                   PLDPNSPAFSESQSSGAEAEPNVGPRNLKGVLSTPSISSERSQIPLRQQQGYRAAEAYL
FT                   RPSPTYVSGKLDSHVFDLKNCVFTLSLTAKGATTATAPTEIYLPDFHFPESNIVVTVSG
FT                   GKWDIDVQDIQGAKLQRLRWWHAEGEQDIKIEGLKRKPGEFGNPGGQDVGYLEQCQKGE
FT                   CVMM"
     atggcacctc ttcatctgaa agtcgaggga cagacctttc gagaccctca caatcgggaa        60
     attacgctaa gggggataaa cgttgcggcc gatgcgaagt atccaaagac acccgacgtc       120
     ccctcataca tcgccgagaa cttctttgac gcggacaatg tctcatttgt tgaacggcct       180
     ttctcacttg aagatgccca tattcacttc aagcgccttc ggaaatgggg ttataacact       240
     atccgataca tctttacctg ggaagccatt gagcatgcgg gaccgggagt ttacgaccat       300
     gagtgggttg catacactat agaagtcctc cggatagcga aacaatatga tttctgggtg       360
     tttatggacc cccatcagga cgtgtggtct aggttatcgg gaggatctgg ggcaccgatg       420
     tggacgctct atgcagcggg actaaaccct agaaccttca aagacacgga agccgccttg       480
     gttcagaaca cgtacgacat ccccgcggag tttcctaaga tgatctggag cacaaactat       540
     actagactgg tttgtcaaac catgtttacg ttattttggg ctgggcggga ctttgctcct       600
     aaggcaatca ttgatgggat gaacatccaa gattatctcc aggaccactt catcaatgca       660
     tgtgcgtttt tggctcggag aattcatgaa gcgggtgatc ttggcgaagt gatcattggc       720
     tgggagagta tgaacgagcc tcatcgcgga cttgttggtg tacaagacat ttcagtgatt       780
     ccgccggagc aacaacttca actaggtact tcaccgacag cattccaagc aatgctcact       840
     ggctcaggca aggcttgtga acagacaaca tgggcatttg gaaacttcgg accttacaag       900
     actggcacaa atctagtgga tccggcaggt gtcatagctt ggttgccagc tgaccaatct       960
     tttaatgata accaatatgg ctggcaacga gaccctgggt ggaaacttgg agagtgtatc      1020
     tgggctcagc acggagtttg ggacccgtcc acagacgtcc ttctacagaa ggattacttc      1080
     tcaaagaaac ctacgggcga gccgcttgac tatgagaaat ttaccaactc gtacttcttg      1140
     gatcattacc gagcatacaa aaatgccatt cgaagaatct ggcccgacgc aataatgttt      1200
     tgccagccac ctgtgatgga ggtgccacct gatatcaaag gcactactga cgatgacccg      1260
     aacatggtcc atgcggttca tttctatgat gggttgactc ttttaacgaa acattggaac      1320
     cggctctaca atgtagatgt tattggtgtt ctccggggca agtacctcac ccctgccttt      1380
     gcgcttaagg tcggtgagac ggctattcgc aactgtttgc gtgaccaact caaattcctc      1440
     cgcgatgaaa gccggaatta tatgggcagt catccggtgg tgtttacgga aattggaatt      1500
     ccctatgaca tggacgacaa atatgcatac aagaccggtg actatagtag ccaaaccagc      1560
     gctatggacg caaatcattt tgcactggag ggcagtacat ctaatggctt tactctgtgg      1620
     gtatatgtca cacaaaatga ccacgaatgg ggtgaccaat ggaatgggga ggacctgtct      1680
     atatattccc gcgacgatct agacctgccc gcaggatcca gcactcggcc tctggatcca      1740
     aattccccgg ccttctccga aagccagagt agcggagcag aagcagaacc aaatgttgga      1800
     cctcgtaatc tcaaaggtgt tttgtcaact ccctcgatct ctagtgagcg ctcccagata      1860
     ccgctacggc agcaacaagg ttatcgcgcc gcggaggcat acctccgccc tagtccaacc      1920
     tacgtcagcg gaaagttgga tagccatgtt ttcgacctga agaattgtgt gtttactctc      1980
     tcgctgacgg ctaaaggggc aaccaccgca actgccccca ccgaaatata tcttcccgat      2040
     ttccatttcc cggagagtaa catcgtcgtc acagtcagcg gtggcaagtg ggacattgac      2100
     gtccaggaca tacagggtgc caagctacag cgcctgcgat ggtggcatgc cgaaggagaa      2160
     caggatatca agatcgaggg actaaaacgc aagcctgggg agtttggtaa ccctggaggc      2220
     caagacgtcg gctatctgga acaatgccag aagggcgagt gtgtcatgat gtga            2274
//

If you have problems or comments...

PBIL Back to PBIL home page