(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE385

PENCW_16.PE385       Location/Qualifiers
FT   CDS_pept        join(882494..882609,882666..882866,882916..886891)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000195859" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948895"
FT                   /orf_name="Pc20g03850"
FT                   /product="Pc20g03850 protein"
FT                   /function="binding"
FT                   /protein_id="CAP85714.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="InterPro:IPR001440"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniParc:UPI00018312DE"
FT                   /db_xref="UniProtKB/TrEMBL:B6HH55"
FT                   /transl_table=1
FT                   /translation="MSGKAALKAVRAALESKDFQVAAEKAKELVKNEPNNYHANVFLGL
FT                   ASDRLNKNNDAENAYFAATAINPNDKTAWQGLVSLYEKQGGCQHDGYHNAVIALGMIFA
FT                   ENDEKERCQDLINKYTKSMKSKGTPTQHKHALELQIPGSPLYDFLEGRLPRPSQTYQRL
FT                   IEITERQEREFINREIGERRTRLGARIEQVTQEVRKEAASKSGLDQYYQGMIDWTNDDA
FT                   VRRHYEEKLFQRAYEELGFLPNAAKEEKRAAVFKAAHDMVIIKHPFEPAWKVYLGWLDV
FT                   KDLSQYDVGHLREYIEFFPESGLSQVLKGFLLSDLSPFPRDPSDETQGKDAKDSKETAA
FT                   TQADNEVDDDAPAPQDPFALMVEGLNSARDSILAHRIMAYVYLSFEEYGSVVTVARKGL
FT                   LYVETLVKYSGVEIPNTIDALNNALANALIYYQSPRHHTDAKQIFEGILERNPTSSNCL
FT                   LGIGLILEEDQDYAEAVDFLRRSLERDPSNLKIRGELAWCEALNGDLEGGLASLQATLD
FT                   DLLEAQPDNREFKSELFYRIGYCQWELDPSPTARKDRSGAYASLLASIQTNMNFAPAYT
FT                   ILGFYYADYKKDKARARRCFHKAFELSTSEIEAAERLARDFADSKEWDLVEAIAQRVVD
FT                   SGKARPSPGSKRRGFSWPYAALGSVQVNKQQYSKSIVSFQAALRLAATDYHSWVGLAES
FT                   YHHSGRYNAATKAFEQAKLLEPELSAKDKEHIWFARYMLANVRRELGQYDEAIAAYEDV
FT                   LKSRPDDIGVTLALLQTLTESSTKSLGLGLFNDAADLACQAISVATSLAQNRSDIFNLW
FT                   KAVGDVFSNFSYMKAKAVKLSASSCKTLLAIDLDPMALDVMTDIDGVGTDCLAGNESEE
FT                   SMPSELHVHLPIIAFKRALHVTMHDAHSQAIAWHNLGWAEYLAHRTAQPDLTKKGKKSR
FT                   KFLKAAMRCFKRAIELEAGNPDFWNSLGVVTATMSPKVSQHAFVRSLHLNERNGQVWAN
FT                   LGALYLLHGESYQSYKIFMRAQATDPDYSLAWVGQGFVSLSVGETQEAKGYFEHAFDIS
FT                   NSSDILTKRQFSLAYFDHLTEASSDMSELIQPSFALHQLCIQEPSNLPFVHLSALLAER
FT                   MGETADAESSLQVVCSDMEDEFEKTESPDSLSRYAQANADMARVLLARQSYEEAAEKSE
FT                   LALTLSGEEDAEKFDPEACKKLRLSAHLTAGLAFYNLKSMDKAIDMFRDALEEAGNAPD
FT                   VVCLLAQVLWAKGGEENRSVAREQLLDCVMSNPTHVGAVTLLGAIALLDVDRDAIEAVE
FT                   SDLNSMVSRDDISLHDRAKIIKLLSAISAMGLKDNAALPESIRRMGDATAAVMLTPGQP
FT                   ASWMELSAASQNPYPSAMTIKRALRSVPPYGKLGAEDLSRAYSHTGKVGDALRAIMIAP
FT                   WKRNGWEELTHNVPTPNMWTRSTGHGPE"
     atgtcgggca aagcggcgct gaaagctgtg cgagcagctt tggagtcgaa agatttccaa        60
     gtcgctgctg aaaaagccaa ggagcttgtc aagaacgagc cgaacaatta ccacgcgaac       120
     gtcttcctcg gtctcgccag cgatcgattg aataagaaca atgacgcaga gaacgcttat       180
     tttgctgcca ctgctatcaa tcccaacgat aaaactgctt ggcagggctt ggtctccctg       240
     tatgagaaac agggtggttg ccagcatgat ggttatcaca acgcagtcat tgctcttggg       300
     atgatattcg ccgagaacga cgagaaggaa cgctgccaag atctgattaa caaatacacg       360
     aagtcgatga agagcaaagg gaccccaact caacacaagc atgcattgga actccagata       420
     ccgggctcgc ccctgtatga cttcctagag ggccggttgc cccgtccatc ccaaacatac       480
     cagcgactga ttgaaatcac cgagcgccaa gaaagagaat ttatcaatcg tgagattgga       540
     gagcgcagaa cgcgccttgg tgctcgaatc gaacaagtca cccaggaagt tcggaaagaa       600
     gctgccagca agagcggttt ggaccaatat taccaaggaa tgattgattg gaccaacgac       660
     gatgcagtac gccgtcatta cgaggagaag ttgtttcagc gtgcatatga ggaacttgga       720
     tttctgccta acgcggcgaa ggaagaaaag agagcagccg ttttcaaggc agcacatgac       780
     atggtgatca taaaacatcc gttcgaaccc gcatggaaag tttacctggg gtggctggat       840
     gttaaggatc tctcgcagta tgacgtgggg catctgcgtg agtacattga gttcttccca       900
     gaatctggac tctcgcaagt tctcaaaggc tttttgttga gcgacctgtc accttttccc       960
     cgtgacccat cggatgaaac acaaggcaaa gatgccaagg acagcaagga aaccgcagcc      1020
     actcaggctg ataacgaagt tgatgacgat gcacctgccc ctcaagatcc tttcgccctt      1080
     atggttgagg gcttaaattc tgctcgagat tcaattcttg ctcaccgcat catggcatat      1140
     gtttacctct ctttcgaaga gtatgggagc gtggtcactg ttgctcgtaa aggattactg      1200
     tacgttgaga ccttggtcaa gtacagtggg gtcgagatcc ccaacaccat cgatgccttg      1260
     aacaacgcac ttgccaatgc cttgatctat tatcaatctc cccggcatca cacggatgcg      1320
     aaacagatat ttgagggtat cctcgaacgg aacccaacct cctccaattg cctgcttggt      1380
     attggtctta ttttagaaga ggatcaggac tacgcagaag ctgtcgactt cctgcgccga      1440
     tcacttgaac gcgatccttc taacctcaag attcgtgggg aacttgcttg gtgtgaggca      1500
     ttgaatggcg atctggaagg tggcctagcc agccttcaag ctacgcttga tgatctgctg      1560
     gaagctcagc cagataacag ggagttcaaa tccgagcttt tttaccgcat tgggtactgc      1620
     cagtgggagc ttgatccgtc cccaaccgcg cggaaagatc gcagtggtgc ttatgctagc      1680
     ctacttgcct ccatccaaac gaatatgaac ttcgctccag catacacgat ccttggtttc      1740
     tactacgcgg actacaagaa ggacaaggcc agagctcgca gatgcttcca caaggcattt      1800
     gagctgtcaa cctctgaaat tgaagccgcc gagcgtcttg ccagggactt tgccgactca      1860
     aaggaatggg accttgtcga agcaattgcg cagcgggtgg ttgactccgg caaggctagg      1920
     ccttcccctg ggtcaaagcg ccgagggttc agctggccat atgcggctct ggggtctgtt      1980
     caggttaaca aacagcaata cagcaaaagt atcgtgtcct tccaagcagc gcttcgactc      2040
     gcggcaacag attaccactc atgggtcggt cttgccgaaa gctatcacca ctctggtcga      2100
     tacaacgctg ccaccaaggc ttttgagcaa gcgaaactat tggaacctga gctttcagct      2160
     aaagacaagg agcacatatg gtttgccagg tatatgctgg caaacgtcag gcgagaactt      2220
     ggccagtatg atgaagctat cgctgcctac gaagatgttc tgaaatcccg gcctgatgac      2280
     attggtgtga ctctcgcgct tcttcagacc ctgactgaga gttcgacgaa gagccttggc      2340
     ctgggcctct tcaatgatgc ggcagacctc gcgtgccaag ctatttcggt ggccacctcg      2400
     ctggcacaga accgaagcga tatcttcaac ttatggaagg ctgtaggcga tgtcttctcc      2460
     aacttctcgt acatgaaggc caaggctgtg aagctgtctg cttccagttg caagacttta      2520
     ttggcaattg atctcgaccc tatggccctt gatgttatga ccgatatcga tggcgttgga      2580
     actgattgcc tcgcaggcaa tgaaagtgaa gagtccatgc cgtctgaatt gcacgttcac      2640
     ctgccaataa tcgcttttaa acgtgcactt catgtcacca tgcatgatgc tcattctcaa      2700
     gcaattgcct ggcacaacct tggttgggct gagtacttgg cccatcgcac tgcgcaaccg      2760
     gacctgacca agaaaggcaa gaagtctcgt aagttcctga aagcagccat gcggtgcttc      2820
     aagagagcaa ttgaattgga ggcgggaaat cccgatttct ggaactcatt gggtgtcgtc      2880
     actgcaacca tgagtcccaa ggtatcccag catgcgtttg tgcgaagtct gcatctgaat      2940
     gaacgcaacg gccaagtttg ggccaacctt ggagcactct acctcctcca cggagagtcc      3000
     tatcaatcgt acaaaatctt catgcgcgcg caggccaccg acccagatta ctcactcgct      3060
     tgggtcggcc aaggcttcgt ttcacttagt gttggcgaga cacaggaggc gaagggttat      3120
     ttcgagcatg ccttcgatat ctcgaattcg tccgatattc tcactaagcg ccagttcagc      3180
     ctggcttact ttgatcatct tactgaggcc tcctctgaca tgtccgagct cattcagcca      3240
     tccttcgcac tgcaccaact ctgcatccag gagccctcta acctgccctt tgtgcacctt      3300
     tctgccctgt tggcagagag aatgggcgag accgcagatg ccgagtctag cttgcaggtt      3360
     gtgtgttcag acatggaaga cgagttcgaa aagaccgagt ccccagattc cctgtcgagg      3420
     tatgcccaag caaacgcaga tatggctcgt gtcctgcttg cacgccaatc ttatgaagag      3480
     gctgcggaga agtccgagct cgcgctcacc ctctctggag aggaagacgc tgagaaattc      3540
     gaccccgaag cctgcaagaa gcttcgtctg tctgcgcacc tgaccgctgg tctagcattt      3600
     tacaacttga agtctatgga caaggccatc gatatgttcc gtgatgccct cgaagaggca      3660
     gggaacgctc cagatgttgt ttgtcttctt gctcaggtcc tgtgggccaa gggcggggag      3720
     gagaatcggt ctgttgctcg cgagcaactg ctcgactgcg tgatgagtaa ccctacccat      3780
     gtcggagcag tcaccctttt gggtgccatc gctctcctcg atgtggaccg agacgccatt      3840
     gaagcagttg aatcagatct taacagcatg gtctcacgcg atgacatcag tctccacgac      3900
     cgagctaaaa tcatcaaact cctaagtgcc atctcagcaa tgggactcaa ggataatgca      3960
     gccctccctg agagcatcag gcgcatgggc gatgccaccg ctgccgtgat gcttacaccc      4020
     ggccaacctg ctagctggat ggagttgtcg gcagcatcgc aaaacccgta cccatccgct      4080
     atgactatca aacgcgctct gcggagcgtg cctccttacg gtaaactcgg agccgaggat      4140
     ctcagccgag cctactcgca caccggcaag gtcggtgatg ccctccgagc gatcatgatt      4200
     gccccgtgga aacgcaatgg atgggaggag ctgacccaca atgtacctac cccgaacatg      4260
     tggacgcgct ctacaggaca cggaccggag tga                                   4293
//

If you have problems or comments...

PBIL Back to PBIL home page