(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE386

PENCW_16.PE386       Location/Qualifiers
FT   CDS_pept        complement(887144..887878)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000195870" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948896"
FT                   /orf_name="Pc20g03860"
FT                   /product="Pc20g03860 protein"
FT                   /protein_id="CAP85715.1"
FT                   /db_xref="InterPro:IPR013894"
FT                   /db_xref="UniParc:UPI00018312DF"
FT                   /db_xref="UniProtKB/TrEMBL:B6HH56"
FT                   /transl_table=1
FT                   /translation="MTSPDQIAAQILSTKSLPVSQTWLNAFLSSSSTAQRNIPASALAK
FT                   SAIFRLLASDIRESLSKHRSYVLPVDIHNPAVQERRLQGSIPVQVLDIEDIGTSLWSQI
FT                   EAIERVERGEAIRGREIVRTIAIGEDPEASENNRANNNPANGAASASGNSGYGPHRLIL
FT                   QDAAGTMVMGIEMQRIDGIALEKLAIGAKLLLRNPSVARGMLLLSPESVTLLGGKIEAL
FT                   DKPWREGRKARLLEKTAGVERE"
     atgactagtc ctgaccaaat tgcagctcag atactgagca caaaatccct cccagtctcc        60
     caaacctggc tcaatgcctt cctatcatcg tccagcacag cacaacgcaa tatccccgcc       120
     tcggctctcg caaaatcggc tatatttcga cttctcgcct ctgatatcag agaatcactc       180
     tcaaaacaca gatcatacgt actaccagtc gacatccaca acccagcagt ccaagagcga       240
     cggctgcaag gctcaatccc cgtgcaagtg ctagacattg aagacatcgg cacgagtcta       300
     tggagccaga tcgaagcgat tgaacgcgtt gagcgcggcg aggcaatccg cggccgtgag       360
     atcgtgcgca caatagctat aggcgaagac cccgaggcat cggagaacaa tcgtgcgaat       420
     aacaaccctg cgaacggtgc tgcgagtgcg tcggggaaca gtgggtatgg accgcaccgc       480
     ctgattcttc aggatgcagc gggaactatg gttatgggta ttgaaatgca gcgtattgat       540
     gggatagcgt tggagaaact tgctattggg gcgaagctcc tgctccgtaa tccgtctgtt       600
     gcgagaggca tgttgctgct ttctccggag tccgttactt tgcttggggg caagattgag       660
     gctttggata aaccgtggag ggagggcagg aaggctaggt tgctggagaa aactgcaggc       720
     gttgagagag aataa                                                        735
//

If you have problems or comments...

PBIL Back to PBIL home page