(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE387

PENCW_16.PE387       Location/Qualifiers
FT   CDS_pept        888053..888934
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000195881" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19824645"
FT                   /orf_name="Pc20g03870"
FT                   /product="Pc20g03870 protein"
FT                   /protein_id="CAP85716.1"
FT                   /db_xref="InterPro:IPR014812"
FT                   /db_xref="UniParc:UPI00018312E0"
FT                   /db_xref="UniProtKB/TrEMBL:B6HH57"
FT                   /transl_table=1
FT                   /translation="MSTISSPRPSIASSRAHSPGPTSSRPSLDVLNTNVSGGLSAASTP
FT                   STARALSPSLHPRRNRSALRDYYNLKPPGADSSASRDVSRSRSVPRNTDAGDISDPTAL
FT                   TAGTELDSADFDPQRYVEHLLSTSSLATVLKAENTLVGDIRTLDGERKALVYDNYSKLI
FT                   RAVETIGKMRRSMDDRSAPLTMTKTLGPAIAFVAETAGGLIKEGEEQRRQMKEAKAEDE
FT                   ASSQKNEKDTVRWVLATPQRLEKLVAEDKQEDAEKDWKEIQHLLDVWGDVKGVAEIREA
FT                   CEKVMNRASHDD"
     atgtcgacta tttcatcccc acgtccgtcc attgcctcct cccgagccca ctccccgggt        60
     ccaacctcct cccgcccatc actcgatgtc ttgaacacca acgtcagcgg gggcctcagc       120
     gccgcatcta ccccatccac tgcacgtgct ctatccccct cactccatcc ccgacgcaat       180
     cgcagcgccc tgcgagacta ctacaacctc aaaccgcccg gcgcggactc atctgcttcc       240
     cgagacgtat ctcgctctcg gagtgtgccg cggaacacag atgcaggaga catctccgac       300
     ccaactgctt tgacggcagg aacggagctc gacagtgcag acttcgaccc gcagcggtac       360
     gtcgagcatc tcttgtcaac atcgtcgctg gccacggtgc tcaaggcgga gaacacgttg       420
     gttggggata tccgcactct cgacggagag cggaaggcgc tggtctacga taactactcc       480
     aagttgattc gcgccgtgga gacaattggt aaaatgcggc gtagtatgga tgatcgcagt       540
     gcgccgttga ctatgacgaa gacgctgggt ccggccattg cttttgttgc tgagaccgct       600
     ggtgggctca ttaaggaagg cgaggagcag cgacggcaaa tgaaggaagc gaaggcggaa       660
     gacgaggctt ccagtcagaa gaatgagaag gatacggttc ggtgggtgct tgctacaccg       720
     cagagattgg aaaagcttgt ggcagaggac aaacaagagg atgccgagaa ggactggaaa       780
     gagatccagc atttactcga cgtttggggt gatgtcaaag gggtcgctga aattcgggaa       840
     gcgtgtgaga aagtcatgaa ccgggcaagc cacgatgact ga                          882
//

If you have problems or comments...

PBIL Back to PBIL home page