(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE388

PENCW_16.PE388       Location/Qualifiers
FT   CDS_pept        complement(889336..890294)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20671931"
FT                   /orf_name="Pc20g03880"
FT                   /product="Pc20g03880 protein"
FT                   /function="nucleic acid binding"
FT                   /function="zinc ion binding"
FT                   /protein_id="CAP85717.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR001878"
FT                   /db_xref="InterPro:IPR004875"
FT                   /db_xref="InterPro:IPR006600"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniParc:UPI00018312E1"
FT                   /db_xref="UniProtKB/TrEMBL:B6HH58"
FT                   /transl_table=1
FT                   /translation="MPPIRSRSSKESTKXEGRILLAIKAFKNKEIFLIRETTRRFKIPR
FT                   STLSSRLTRIXHRANYRVNSCKLIEIEEESLXKXILSIDSXGLAPRLSIVREIANLLLK
FT                   KRGTTPVLSVGENXVTKYIKRHPLLSSRFSKRYNYERAKYKDLKVIKDXFDLIXKTILQ
FT                   FRIYPDNVYNFNKTGFTIGLIATTKVITRSEYYSRRALLXPRNREXVIAIECTNTASXA
FT                   LLLYLIFKGKVFIKSXFDSLPSDXRFEVSPNSXTTNEIRLRXLKKLFIPTTFIRIKGVY
FT                   RLLILDSYRSYLIPRFNKIYKKNRVILIYIPPYLSYLLQPLDIGYFIVLKRTYRRLVKF
FT                   RIRYGSNYIDKLDFLDSYPTARIEAFKLEIVKNSFXSTGLVPFALERVISKLNIRLTTL
FT                   TPPPSRGSDWDLKIPLNYRQLEKXASSIKALLRTRLGSPLSPLNSAINQVLKAYXITMQ
FT                   SATLLEREVSDLRSETEKKKQKRARSRKYLYAESGLSVXEASALIIQPVEVAEPGPGXH
FT                   SESGLQPRIKPPRGCGVCRKPGHRREICPDR"
     atggaatcaa ccacagtagt cgatgaaata ttctccgacg agtcaagctt ctacggtaaa        60
     ctcatctcag accccaaccc caggaagcca gctaaccaat accaggcgac gacgatgaga       120
     agacacaact agaagcacaa gtctcatcct acgacccaga gccattctgg gtaggaaccc       180
     accagaagct tctatcaacc atccagcagc atctgcgcgc gccgacacgc gcaaaggccg       240
     catcatcaga catttccatg gacaatgcat ccccagaagc agacagcata ccgcgcaacc       300
     agcgcgggaa gaccgagccc atagctcgat ttctatcacg tcttccgcca tcaacaacag       360
     aatctgcaag cgtaggcccc tggatctgga tgtacaaccc gcatatgtcg ccgaggccgg       420
     agggagatgt tcccactcta cttaggaaag gcagggagct tctccaggag tatgaggatg       480
     agagtgcgat gctgcgcgag aagcatgata agtctggtgc gaagactacg gctgccttga       540
     ctcggaaatt aaatccgatg cggagggagc tagagagggg tattcttgat cttgcgaggg       600
     agacgggtgt tattggtggg aaatggatgc tttttccgac tgttgaccag gttgatgagg       660
     tctggggggt tgttgttaga gctatggaga agggggagct tggggatgtg gcgaaagttg       720
     ctactgatga tggtggtgga gagagtcgtt taatttgtgt ttatacgaag gatttcgggg       780
     atgttgagga tgttaagagg gttgtgagta agttggttga tattggcctt gtcgggaagg       840
     ggccccggtc tatttactac aagtctgatg cgtttactca tctggagatt agctctaaga       900
     atgagtatgg gctgaaggcg agtatgtatt cgagtcgtga ggtgcttgag gggaaatag        959
//

If you have problems or comments...

PBIL Back to PBIL home page