(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE390

PENCW_16.PE390       Location/Qualifiers
FT   CDS_pept        join(complement(894704..894788),complement(894379..894624),
FT                   complement(893484..894323),complement(893240..893413),
FT                   complement(893075..893169))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000185710" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948897"
FT                   /orf_name="Pc20g03900"
FT                   /product="Pc20g03900 protein"
FT                   /function="tetracycline:hydrogen antiporter activity "
FT                   /biological_process="response to antibiotic"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAP85719.1"
FT                   /db_xref="GO:0015520"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0046677"
FT                   /db_xref="InterPro:IPR001958"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI00018313B2"
FT                   /db_xref="UniProtKB/TrEMBL:B6HH60"
FT                   /transl_table=1
FT                   /translation="MNDTKPWGYRWRSSRLLVVSSITVALFAETFLYGFLTPILSYMLE
FT                   ERLHLAPSQTQSYTTALLATHGFIGLVSAPIVAHLAERTPSQKKPLLIALAGCFIGTLM
FT                   IALAPSLWLLFLGRILQSMAGAATWVVGFALLANNVDKKHLGQSMGTAMSFVTAGIVGG
FT                   PTVSGALLQLFGYWAAWSLPLIVLVLDIIARLVMIEPGPGYSNIDALSKPAATSVPSNG
FT                   SPEESTALLSDTLSMVNPDESGVESKHNLKQEYYRAMLSEPRVLTALANVVVVSSLMSG
FT                   INNTLPVHLRQAFGWKSLLISTMFFCLQVPNIVLSGPSGWLRDRIGIRGPTVFGWLAMI
FT                   PLLLLLGMPGDAHFPWAGGHAAGKSIFTSSLIALGSILPLVRGVGAVQLAYVVKDMEAK
FT                   DPHIFEANKSNLRVFSMTEVGYSLGMMLGPLLTGSLFEGVGFFYMTVALGSDFLALAGY
FT                   LALTRSPRSLSLNIQAVDTYA"
     atgaacgata caaagccatg gggctataga tggcgttcat ctcggcttct ggtggtttca        60
     tccatcactg ttgccttatt cgcagagaca tttctctacg ggtttcttac tccgatctta       120
     agttatatgc ttgaagagcg actgcatctt gctccgtcac agactcagtc gtataccaca       180
     gctttgctcg ccacacatgg gtttatcggt ctcgtctctg ctccgattgt cgctcacctt       240
     gccgagagga ctccgagcca gaagaaacca ctgttgatcg ctctagcagg atgtttcatt       300
     ggaactctta tgattgctct tgccccgtct ctttggctcc tcttccttgg tcgcatcctg       360
     caatctatgg caggcgccgc cacttgggtg gttggatttg ctctattggc aaacaatgtg       420
     gacaagaaac atctcgggca gtcaatgggg acggccatgt cctttgtaac tgcaggaatt       480
     gtcggcgggc caacagtgag tggcgcattg ctccagctat ttggctactg ggccgcctgg       540
     tcacttccct tgatcgtact tgtcttggat atcattgccc gtctggtcat gattgagcct       600
     ggccccggat attcaaacat tgatgctttg agcaaacctg ctgccacttc agttcccagc       660
     aacggtagcc cagaagaatc gactgctctg ctttctgata cactgtctat ggtcaaccca       720
     gatgagtctg gagtggagag caagcataac ctcaaacagg aatactacag agctatgctc       780
     tctgaacccc gtgtgttgac ggcgttggcc aacgttgttg ttgtctcctc gctcatgtct       840
     ggcattaaca acactctccc cgtccaccta agacaagcat tcggttggaa gagtttactc       900
     attagtacga tgttcttctg tctccaagtc ccgaatatcg ttctgagcgg cccatctgga       960
     tggcttcgcg accgaatcgg aatacgggga cccaccgttt tcggctggct tgccatgatc      1020
     cctctactcc tacttctagg gatgcccgga gatgcccact tcccttgggc cggaggacat      1080
     gcagctggga agtctatctt caccagcagc ttgattgctt taggtagtat tctacctctt      1140
     gtgcgcggcg taggagccgt gcaactagcc tatgttgtca aggatatgga agcaaaagac      1200
     ccgcatatat tcgaggccaa caaaagtaac ctgcgagtgt tttccatgac tgaagtggga      1260
     tacagtctcg gtatgatgct cgggcctttg ttgaccggtt cactatttga aggtgttggc      1320
     ttcttctaca tgactgtggc attaggctct gatttcctgg cgttggctgg ataccttgcc      1380
     ctcactcgaa gcccccgaag cctcagcttg aacattcagg cagttgatac gtatgcgtga      1440
//

If you have problems or comments...

PBIL Back to PBIL home page