(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE391

PENCW_16.PE391       Location/Qualifiers
FT   CDS_pept        join(896139..896344,896431..897475)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000196009" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948898"
FT                   /orf_name="Pc20g03910"
FT                   /product="Pc20g03910 protein"
FT                   /protein_id="CAP85720.1"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="UniParc:UPI00018313B3"
FT                   /db_xref="UniProtKB/TrEMBL:B6HH61"
FT                   /transl_table=1
FT                   /translation="MAGIHHPQSATTVFLDQPPSCLEFCPETPDHFIVGTYLLSENKTE
FT                   DGEVEQSKTGSLQLWNLDPVSKTLSQIQRIAVPYAVFDLHFHPRHKNLFAIASSVGSVA
FT                   LFQVSTNSTTGDASATPSITQLWTKQVHEDPSIPALFLAWAPQNWFPKPADGFAVTFSD
FT                   SRTAVFGTEGDIRQEESIAEWGTYEAKQMIEVWFVALSTSTGNPDPETQNPSAIPFMFT
FT                   GNDFGSLHTRRFDNSTELDDPDEHISPMLLEHDDRARHHTAGVTAILPLDVPLVDDAPV
FT                   LLTGCYDEGLRVYRATRRGEVLAEQGLDGGVWRLQLLNTTRIPGSDDPSNVAEYRFLVL
FT                   ASCMHAGTRLVRVTCKHEDGAPTWGIEVLAKFTEHESMNYASGVWKGGQEMTRSSEVLC
FT                   VSSSFYDRRLCVWTVDL"
     atggcaggca ttcatcaccc ccagtcagcg actacagttt ttctagacca gccacccagt        60
     tgcctggagt tctgccccga gaccccagac catttcatcg tgggaaccta tcttctatca       120
     gagaacaaaa cagaagatgg agaagtcgag cagtccaaaa ctgggagtct acaactatgg       180
     aatttagacc ctgttagcaa aacattatcc caaatccaaa gaattgccgt cccatacgca       240
     gtatttgacc tgcatttcca ccccagacac aaaaacctat tcgcaatcgc aagcagcgtg       300
     ggatccgtgg ctttattcca agtatccacc aactccacca ctggagacgc atccgcaacc       360
     ccaagcatta cccaattatg gacgaagcaa gtacacgaag acccctcaat cccagcactt       420
     ttcctcgcct gggcaccgca aaactggttc ccaaagccag cagatggctt cgccgtcaca       480
     ttctcagata gccggacagc cgtcttcggc acagagggcg atatccgtca agaagaaagt       540
     atagcagaat ggggcacgta cgaagccaaa caaatgatcg aagtctggtt tgttgcattg       600
     tcaacaagta cgggaaaccc agaccccgag acccagaacc catctgcgat cccgttcatg       660
     ttcacgggca atgacttcgg ctcgctccat acgcgccgat tcgataatag caccgagttg       720
     gatgatccag acgagcatat ctcgcccatg ctgcttgaac atgatgaccg agctcgtcat       780
     cacactgctg gtgttactgc catcttgcct cttgatgttc ccttggtcga cgatgccccg       840
     gttcttctga cgggttgcta tgatgagggt ctgcgtgtgt atcgtgctac gcggagggga       900
     gaagttctcg ctgagcaggg gcttgatggt ggggtttggc gactgcagtt gctgaacacg       960
     acgaggattc cgggctcaga tgacccgtcg aatgtcgccg agtaccgctt tctggtgctg      1020
     gcgagctgta tgcatgccgg gacgaggctt gtgcgggtta cgtgcaagca cgaagatggg      1080
     gctccgactt gggggattga ggttctggcg aagtttaccg agcatgagag tatgaattat      1140
     gccagtggtg tgtggaaggg tggacaggaa atgactcggt cttctgaggt tttgtgcgtc      1200
     tcgagcagtt tctatgatcg caggctctgt gtttggactg tcgatctata g               1251
//

If you have problems or comments...

PBIL Back to PBIL home page