(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE393

PENCW_16.PE393       Location/Qualifiers
FT   CDS_pept        join(complement(899809..901304),complement(899476..899761))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000171253" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18128994"
FT                   /orf_name="Pc20g03930"
FT                   /product="Pc20g03930 protein"
FT                   /function="serine-type endopeptidase activity"
FT                   /biological_process="proteolysis"
FT                   /protein_id="CAP85722.1"
FT                   /db_xref="GO:0004252"
FT                   /db_xref="GO:0006508"
FT                   /db_xref="InterPro:IPR000209"
FT                   /db_xref="InterPro:IPR009020"
FT                   /db_xref="InterPro:IPR015366"
FT                   /db_xref="UniParc:UPI00018313B5"
FT                   /db_xref="UniProtKB/TrEMBL:B6HH63"
FT                   /transl_table=1
FT                   /translation="MRLQFLLLRALGLFLCYTQLVFAVDASYELVEQLDKAPDGWSRGD
FT                   KPPASKFIKFRLAIAQHNAREFEQKVIELSTPEHPSYGQHMSRDEVKQFLTPHPAISDR
FT                   IIAWLRSENVPANSINLYGHWVSFIVPIFQAERMLKTQFFYFHQQGQENPAIRTLGYSV
FT                   PRALRSHIQLIQPTTLFGNLVPQKSPVFKQKIATPEKLAAGCDVTITPDCLRDLYKIDN
FT                   TTTRPDWRNRLGISGFLEQYARHDDFNEFLRRYAQSHTDANFSVVSINGGQDGQHSMSD
FT                   SVEANLDVQYSIPLADEVLATFYSTGGRGPVVPEITHPDPTESSNEPYLEQLHYLLDLP
FT                   DEELPAVLSNSYGENEQSLPPSYLNATCSLFAQLGARGVSILFGSGDSGPGSSCVKNDG
FT                   TNQTRFLPGYPASCPFVTAVGGTYGTNPEKAVPFSGGGFSEVFSRPQYQDQAVKGYLGH
FT                   LGNQWNGLYNATGRGYPDISAQAANFIVRDQGDWISVGGTSASTPVLAGVISRLNAARI
FT                   AQGKPRMGFLNPWLYSHGQTGFTDIVLGSSSGCKWTSDARVRNASWDATEGWDPATGLG
FT                   TPLFPALVKLVLSDGQA"
     atgagactgc aatttctact tcttcgagcc ctgggccttt tcctatgcta tacccagttg        60
     gtgtttgccg ttgatgccag ctacgaactg gttgaacagc tagacaaggc accagatggc       120
     tggtcaagag gggataaacc gccggcctct aaatttataa aattccgact agccattgcc       180
     cagcacaacg ccagagagtt cgagcaaaag gtcatcgaat tgtcaacccc ggagcacccg       240
     agctatggtc aacatatgag tagggacgaa gtgaagcaat tcttgactcc ccaccccgcc       300
     atttcagaca ggattattgc atggctacga tcagaaaatg tcccagccaa ttctatcaac       360
     ttatatggcc attgggtctc atttatagtt ccaatttttc aggccgagag gatgctgaaa       420
     acgcagtttt tctacttcca ccagcaaggc caggaaaacc cagccattcg aactcttggc       480
     tattccgtac ctagggcctt acgttcccat attcaattga ttcagcctac aactctcttc       540
     gggaacctcg tacctcaaaa aagcccggtt tttaaacaga agatagcgac tcccgagaag       600
     ctagccgctg gatgcgatgt gactatcaca ccagactgcc ttcgggacct gtataaaatt       660
     gataacacga ccaccagacc cgattggcgg aaccgactgg gcatatccgg cttcctggaa       720
     caatatgctc gccacgatga tttcaacgag tttttgcgtc gttacgccca aagccacaca       780
     gacgcgaact tcagtgtcgt ctcgatcaac ggcggccagg atggtcaaca ctccatgtct       840
     gacagtgtcg aagcaaatct agacgtacag tactctattc cgctggcgga tgaagtgcta       900
     gcaacatttt atagcactgg gggtcgcggt cctgttgtac ccgaaataac gcatccagac       960
     cctactgagt catcaaacga gccgtatctt gaacagctcc attacctctt ggatctccca      1020
     gatgaagagc tcccggcagt gctatccaac tcgtacggag aaaacgagca gagtcttcca      1080
     ccgtcatatt taaacgcgac ttgcagccta tttgcccagc tcggtgcccg gggtgtttcg      1140
     atacttttcg gtagcggaga ttctggtccg ggaagttctt gtgtgaaaaa tgacgggaca      1200
     aatcaaacta gattcctccc cggatatcca gcttcttgtc catttgttac cgccgtgggt      1260
     ggaacgtacg gcaccaaccc cgaaaaagcg gttcccttct ctgggggcgg cttttcagag      1320
     gtgttctccc gcccccaata ccaagaccag gcagtgaaag gctacctcgg tcatcttgga      1380
     aatcaatgga atggactgta caatgctacg ggaagagggt atccagatat atcagcccaa      1440
     gccgcgaact tcattgttcg ggatcagggc gactggatct cggttggcgg cacaagtgct      1500
     tcaacaccag tgcttgcagg ggtaatatct cggctaaacg ctgcgcgtat tgcccagggt      1560
     aagcctcgaa tgggcttcct aaacccatgg ttgtatagtc acgggcaaac aggcttcacg      1620
     gatattgttc taggcagctc ctcgggctgt aagtggacta gtgatgctcg ggtacggaat      1680
     gcgagctggg atgccaccga gggctgggat ccggcgacag ggctaggcac gcccctattc      1740
     cctgcacttg tgaaattggt attgtcagat ggtcaggcgt ag                         1782
//

If you have problems or comments...

PBIL Back to PBIL home page