(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE394

PENCW_16.PE394       Location/Qualifiers
FT   CDS_pept        join(902849..902966,903056..903216,903268..903981,
FT                   904044..904250)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000195976" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948900"
FT                   /orf_name="Pc20g03940"
FT                   /product="Pc20g03940 protein"
FT                   /function="binding"
FT                   /protein_id="CAP85723.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="InterPro:IPR006599"
FT                   /db_xref="InterPro:IPR012945"
FT                   /db_xref="InterPro:IPR017901"
FT                   /db_xref="UniParc:UPI00018313B6"
FT                   /db_xref="UniProtKB/TrEMBL:B6HH64"
FT                   /transl_table=1
FT                   /translation="MADAEIQQLRRPSADNQTVSKADIPLKERFFRYFQHEITDLQQEM
FT                   DRLADTSLVGGERADATDHCLAGIVRLSNEVKDAASYIPTYDQRVYAEAIKALQDRLSE
FT                   TRAAFEPRSKFSFKNKKNTSAVSLSDAAVLGVEGRLSIPGYHSPGGSSVDSSANNTPNY
FT                   PSTPLNEPDRQQQERPELAPTSFPGVSVGDFGGAKSPAGAFAATGISSVSVDDHQGLHI
FT                   MLPASGSTSTVPVSITSLDRCIVDMSIPTANGKPYASLTAKGVQESLLICGQVNGPAHI
FT                   TGVERSVIVVSCRQFRMHNCSNVDVYLSCSSNPIIEDCSNIRFGRIPKAYALNHDRPDH
FT                   EDRWSQVEDFKWIKPEPSPNWSLLDHNDAVPEEVWAEIVPGGPGWSLEDILHAIKVVPS
FT                   "
     atggctgatg cggaaataca acaactacgt cgcccgtcgg cggataatca gacagtctcg        60
     aaagccgata tccccttgaa ggaacgcttc ttccgctact tccagcatga gatcaccgac       120
     ttgcaacagg agatggatcg tctcgcagac acatctcttg tgggtggtga acgtgccgat       180
     gcaacagacc actgtcttgc cggcatcgtg cggttatcca acgaagtcaa ggacgcagcg       240
     agctatattc ccacttatga tcagagagtg tatgcagagg caatcaaagc tttgcaggat       300
     cggttgagtg agacacgcgc agctttcgag ccccgatcaa agtttagctt caagaacaag       360
     aagaatacct ctgctgtctc tttgtctgac gctgccgtgc tgggagttga aggacgcctt       420
     agtatcccgg ggtaccattc tccgggtggc tcgtccgttg actcgtccgc gaacaacaca       480
     cccaactacc cttccactcc actgaacgag ccagatagac agcaacaaga gcgaccggag       540
     cttgcgccaa cttcattccc aggtgtttca gtcggagact tcggcggcgc aaagtccccc       600
     gctggtgcat ttgcggccac cggcatatcc tctgtgtcgg ttgatgatca tcagggcctt       660
     catattatgc ttccggcctc cgggtccaca tccacagtcc cggtgtctat cacctccctg       720
     gatcgttgca tcgttgatat gtccattccc actgccaatg gaaagccata tgccagcctg       780
     actgccaagg gtgtccagga aagtttattg atctgcggtc aagtcaacgg ccctgcacac       840
     attaccggcg ttgagcgtag cgtgattgtg gtatcatgtc gccagttccg catgcataac       900
     tgcagcaacg ttgatgtcta tctcagctgc tctagtaacc cgattatcga ggactgttcc       960
     aatattcggt ttggtcggat cccaaaggcc tatgccttga accacgaccg ccccgaccat      1020
     gaagaccgtt ggagccaagt cgaggacttc aaatggatta agccggagcc tagcccaaac      1080
     tggagtctgc tcgatcacaa cgatgccgtt cccgaagagg tctgggcgga gattgttccc      1140
     ggcgggccgg gatggtctct tgaggacatc ttacatgcca taaaagtagt cccgagctag      1200
//

If you have problems or comments...

PBIL Back to PBIL home page