(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE395

PENCW_16.PE395       Location/Qualifiers
FT   CDS_pept        join(complement(905825..906717),complement(905552..905766),
FT                   complement(905406..905497))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000195954" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18128995"
FT                   /orf_name="Pc20g03950"
FT                   /product="Pc20g03950 protein"
FT                   /protein_id="CAP85724.1"
FT                   /db_xref="UniParc:UPI00018313B7"
FT                   /db_xref="UniProtKB/TrEMBL:B6HH65"
FT                   /transl_table=1
FT                   /translation="MVARTSSRNAAQKAKEAISTSPEPTGKTSKGTKRKASTEKAPQPK
FT                   KEKTEDTKPDEEKAEHVPDGPAAKREEEPVKAEEPSEAQPPKEKPVEAPSEKPQEVEGG
FT                   LRKSEERENVVSSNILEKGFIYFFFRPRVNIEEPQDIGDVSRSFFVLRPTVLGAEFDKG
FT                   QGPVDKDAKCRLMILPKKKYPTSPKERDMGFVEKAGQTMQELHEKFITGRTFETSTRGE
FT                   RHAEEARPYAEGVYAITSTPRASHLAYILTIPTELGDVQEDFGLQERGSWIVQSKSPKF
FT                   AGPPVGQLPKGPEYPPEVLEKFSDLRWVPLQPEFLDYPNSQFLMIGEAQNDLGKAAFAM
FT                   GGKQQHEEEPGQELEKLEDENENRVDSLKGDETVYEDLGYHAKNYPKVLTTWYTGESET
FT                   "
     atggttgcac gcacatcctc acgcaacgcg gcccagaaag ccaaggaagc catttcgact        60
     tcccccgagc cgactggcaa gacttccaag ggaacgaaac ggaaagcttc aaccgaaaaa       120
     gccccacagc ccaagaaaga gaaaacggag gatacaaagc ccgatgaaga gaaagccgag       180
     catgtaccag acggtccagc agcaaagaga gaggaggaac ctgtcaaggc agaagaacca       240
     tccgaagcac aaccaccaaa ggagaaacct gtcgaagccc cttcagagaa acctcaagaa       300
     gtcgaaggag gtcttcgcaa atccgaggag agggaaaacg tagtctcctc caatatcctc       360
     gaaaaaggct tcatctactt cttcttccgc ccacgcgtca acatagagga accccaggat       420
     atcggcgatg tctcccgaag cttctttgtt ctccgtccaa ccgtcctcgg agcggaattc       480
     gacaaaggcc aaggtcccgt cgacaaagat gccaaatgtc gcctgatgat tctcccgaag       540
     aagaagtatc caacctcacc caaagaacgt gatatgggat ttgtcgagaa agctggacaa       600
     actatgcaag agctccatga gaagttcatc accggtagaa cattcgagac ttccacccgc       660
     ggtgagcgcc acgccgagga agctagaccc tacgctgaag gtgtctacgc aatcacttcc       720
     acaccgcggg catctcacct cgcttacatc ttgaccatcc ctaccgagtt gggtgatgtt       780
     caggaggact tcggcctgca agaacgtggc agttggattg ttcagtcaaa gagtcccaag       840
     ttcgccggtc caccggtggg tcagttacca aaaggcccag aataccctcc agaggtcctc       900
     gagaaattct cggatcttcg atgggtgcct ctgcagccgg agttcctgga ctatcctaat       960
     tcccaattcc tcatgatcgg cgaggcgcag aacgaccttg gcaaggctgc atttgctatg      1020
     ggtggtaaac agcagcacga ggaagagcct ggccaggaat tggagaaact ggaagacgaa      1080
     aacgagaatc gggtggattc tctcaaagga gacgaaaccg tctatgaaga cctgggctac      1140
     catgcgaaga attaccccaa agttctcaca acttggtaca cgggtgaaag tgaaacctga      1200
//

If you have problems or comments...

PBIL Back to PBIL home page