(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE396

PENCW_16.PE396       Location/Qualifiers
FT   CDS_pept        complement(906921..907589)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18128996"
FT                   /orf_name="Pc20g03960"
FT                   /product="Pc20g03960 protein"
FT                   /protein_id="CAP85725.1"
FT                   /db_xref="UniParc:UPI00018313B8"
FT                   /db_xref="UniProtKB/TrEMBL:B6HH66"
FT                   /transl_table=1
FT                   /translation="MGNVPMDDTGPAKPDQPFEYFTGFTSSDAAADHQPEDTEQSMNGS
FT                   GPSTPTQDTDPFEESDNIRTIKPYDIEEPDDDLETSVPRVDILCLPDPFEQWQRELTDS
FT                   LNGLDYEHVGFDSNAMPLVRKRGKKRKPTHNALATQQCYPHLAQEHALAGTQPEEHGHS
FT                   PKRRKFSELQWHAQDIDSFGTFREANANESSGSETASIDLGGGIDGTNNSPMTDEMDID
FT                   "
     atggggaacg tcccgatgga tgacacgggt cctgccaagc cagaccagcc ctttgaatac        60
     ttcaccgggt ttacttcttc tgatgctgca gcagaccacc agccggagga tactgagcag       120
     agtatgaacg gatcaggacc ttctacgcct acccaggaca cggatccatt cgaggagagc       180
     gacaacattc gaaccatcaa gccctacgat atagaagagc ccgacgatga tttagaaact       240
     agcgtgccac gggtagatat actatgtctc ccagatccgt tcgagcaatg gcagcgcgag       300
     ttgacagact ctctgaatgg gttagactac gaacacgttg gatttgatag caatgcaatg       360
     ccattggtgc gaaaaagagg gaagaagaga aagccaaccc acaacgctct cgctacgcag       420
     cagtgctatc cacacttggc acaagaacat gcattggccg ggactcagcc tgaagagcat       480
     gggcactccc caaaaagacg aaagtttagc gaactgcagt ggcatgctca agacatagac       540
     tcatttggga cattccgaga agccaacgcg aatgaaagct caggttccga gacggcatca       600
     atcgacctgg gtggtggcat tgatggcaca aataactcac ccatgaccga cgagatggat       660
     atagactga                                                               669
//

If you have problems or comments...

PBIL Back to PBIL home page