(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE397

PENCW_16.PE397       Location/Qualifiers
FT   CDS_pept        join(908260..908271,908354..908403,908466..908785,
FT                   908845..910743,910795..911879,911944..912198)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000195913" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948901"
FT                   /orf_name="Pc20g03970"
FT                   /product="Pc20g03970 protein"
FT                   /function="structural molecule activity"
FT                   /biological_process="intracellular protein transport "
FT                   /biological_process="vesicle-mediated transport "
FT                   /cellular_component="COPI vesicle coat"
FT                   /protein_id="CAP85726.1"
FT                   /db_xref="GO:0005198"
FT                   /db_xref="GO:0006886"
FT                   /db_xref="GO:0016192"
FT                   /db_xref="GO:0030126"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR006692"
FT                   /db_xref="InterPro:IPR010714"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR011048"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR016391"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="InterPro:IPR019782"
FT                   /db_xref="InterPro:IPR020472"
FT                   /db_xref="UniParc:UPI00018313B9"
FT                   /db_xref="UniProtKB/TrEMBL:B6HH67"
FT                   /transl_table=1
FT                   /translation="MLTKFESKSSRAKGIAFHPKRPWILVSLHSSTIQLWDYRMGTLID
FT                   RFEEHDGPVRGVDFHPTQPLFVSGGDDYKIKVWNYQTRRCLFTLNGHLDYVRTVFFHPE
FT                   LPWILSASDDQTIRIWNWQNRSLICTMTGHNHYVMCAQFHPTEDLIASASLDQSVRIWD
FT                   ISGLRKKHSAPTSISFEDQMARANPNQADMFGNTDAVVKFVLEGHDRGVNWVSFHPTLP
FT                   LLVSAGDDRLVKLWRMSDTKAWEVDTCRGHFQNASAALFHPHQDLILSVGEDKTIRAWD
FT                   LNKRTSVQSFKRDLDRFWVIAAHPEMNLFAAGHDTGVMVFKLERERPASAIYQNQLFYI
FT                   TKDKHVKSYDFAKNVESPPMLSLRKLGSPWVPPRTLSYNPAERAILVTSPADNGTYELI
FT                   HLPRDATGAVEPTDVKRGQATSAVFVARNRFAVFNPSSQQVDIKDLSNSTTKTIKPPAG
FT                   TTDIYFGGTGCLLFITPTHVALFDIQQKKQLAELAVSGVKYVVWSNDGLYCALLSKHNV
FT                   TIVTKTLEQVSTLHETIRIKSATWDDAGVLLYSTLNHVKYSLLNGDNGIIRTLDQTVYL
FT                   VRVKGRSVYALDRNAQPRILEIDPTEYRFKLALVKRNYDEMLQIIKTSSLVGQSIISYL
FT                   QKKGYPEIALQFVQDPQTRFDLALECGNLEVANEMARELERPKIWSRLGAEALAHGNHQ
FT                   IVEMTYQKQRNFDKLSFLYLSTGDEEKLARMAKIAEHRGDFTSRFQNAIYRGDVEDRIQ
FT                   MFKEVDLYPLAYLTAKSHGLIEEAESILEAVGLTEDQIVLPTLEQPLKVPHPIVPTFQS
FT                   NWPVKAAGHSSFEKALLGEVGVDEEAGADGFDIEEEEQEAAVARETLDEDEEEVSGWDM
FT                   GDDVNVEEEVDFVNVESAEAGAGSSEADLWARNSPLAADHVAAGSFDTAMQLLNRQVGA
FT                   VQFAPLKARFLEVYKASKTYLPATAGLPPLVNYVRRTVDETELRKMLPIIPRDLETVAS
FT                   VDLQEGYAAMRSNKLEDGVATFKRILHTVLVNTVSSEAEVEEAKKIIATAREYILAMSI
FT                   ELERRSLTTDSPDNLKRSLELSAYFTIPKLEVAHRQLALMAAMKLAFANKNYGSALSFA
FT                   NRMLANGGSAKLLEQAKKIKAQCERNPQDQIDIDFDPFAEFDICAASYTPIYSGSPSVS
FT                   DPFTGAKYHPQYKGSVDRISDVTEIGAPASGLRLFVPSQF"
     atgctcacca agtttgagtc gaaatcctcc agagccaaag gaatcgcgtt ccatcccaaa        60
     cggccatgga ttcttgtctc cctccactcc tctaccatcc agctatggga ctaccgcatg       120
     ggaaccctta tcgaccgatt tgaagaacac gatggtccag ttcgcggtgt tgacttccac       180
     ccaacccagc ccctgtttgt gtcgggaggt gacgattaca agatcaaggt ttggaactac       240
     cagacccgga ggtgcttgtt cacattgaat ggccacctgg attacgtgcg aacggttttc       300
     ttccaccccg agctgccctg gattctgtct gcgtccgatg accagaccat tagaatctgg       360
     aactggcaaa atcggtcact catctgtacg atgaccggtc acaaccacta tgttatgtgc       420
     gctcaattcc accccaccga ggatctcatt gcctcggcct cgttggatca gtcggttcgc       480
     atctgggaca tctccggcct gcggaagaag cactcggccc caacctcgat ttcatttgaa       540
     gaccaaatgg caagagccaa cccgaaccaa gctgatatgt ttggaaacac cgatgcagtc       600
     gttaaatttg tgcttgaagg tcatgaccgt ggagttaact gggtgtcgtt ccaccccaca       660
     ctgcccttgc tcgtgtccgc cggtgacgac cggttggtta aactctggcg gatgagtgat       720
     accaaggcat gggaggtcga tacttgccgc ggccatttcc aaaatgcctc cgccgctctg       780
     ttccacccac accaggacct tatcctttcc gtcggcgaag ataagacgat tcgcgcctgg       840
     gatcttaaca agcgtacgtc cgtccagtca ttcaagcgcg accttgatcg attctgggtt       900
     atcgctgccc accctgagat gaacctgttt gctgcgggcc atgacaccgg tgttatggtc       960
     ttcaagctcg agcgagagcg ccctgcgtct gccatctacc agaaccagtt gttttacatt      1020
     acaaaggaca agcatgttaa gtcatatgac ttcgcaaaga acgtcgagtc gccgccgatg      1080
     ctttccctac gcaagctggg ttccccatgg gttcctcccc gcaccctctc ttacaacccc      1140
     gccgagcgtg ccattctggt tacgtcgccc gccgataatg gaacttatga actgattcat      1200
     ctccccagag atgctactgg ggccgttgag cctactgatg ttaagcgtgg acaggccact      1260
     tcggcagtct tcgtcgcccg caaccgcttc gctgtcttca acccctcgag ccagcaggtc      1320
     gatatcaagg atctgagcaa ctccacaacg aagacaatca agcccccagc aggcacgacc      1380
     gatatctact ttggtggtac cggatgtctg ctcttcatca cccctacaca tgttgctctg      1440
     ttcgacattc aacaaaagaa gcagcttgca gagcttgctg tcagcggagt gaagtacgtg      1500
     gtgtggtcta atgatggttt gtactgcgct ttgcttagca aacacaacgt caccatcgtg      1560
     accaagaccc tcgagcaggt aagcaccttg cacgagacta ttcgcatcaa aagtgctacc      1620
     tgggatgacg ctggtgtcct gctctactcc acccttaacc atgtgaagta ctcccttctc      1680
     aacggtgaca atggtattat ccgcactctt gaccagacag tatacctcgt gcgtgttaag      1740
     ggacgtagcg tctatgctct tgaccgcaac gctcagccac gcatcttgga gattgaccca      1800
     actgaatacc gtttcaagct cgcccttgtg aagcggaatt atgatgagat gctccagatt      1860
     atcaagacct cgagtctggt tggccagagc atcatctctt atctgcagaa gaagggttac      1920
     ccggagattg ccctgcaatt cgtgcaagac ccccagacgc gcttcgacct tgcccttgaa      1980
     tgtggtaacc tcgaggttgc caatgaaatg gcacgggaac tcgaacgtcc caagatctgg      2040
     agcaggcttg gagctgaggc attggctcat ggtaaccacc agatcgtcga aatgacttac      2100
     caaaagcagc gtaacttcga caaactctct ttcctctacc tctctaccgg tgatgaggag      2160
     aagcttgctc gtatggctaa gattgccgaa caccgtggcg acttcacctc tcgtttccaa      2220
     aacgccattt accgtgggga cgtcgaggac cggatccaga tgttcaagga agtggacttg      2280
     taccctctcg cctatcttac tgccaagtca catggtctga ttgaagaggc cgagtcaatc      2340
     ttggaggctg ttggtctcac cgaagatcaa attgtcctac ccacacttga acaacctctg      2400
     aaggttcctc accctattgt gcccactttc cagtccaact ggcctgtaaa ggctgccggt      2460
     cactcctcct ttgagaaagc tcttcttgga gaggttggtg tggatgaaga ggctggtgct      2520
     gatggcttcg atattgagga agaggagcaa gaagctgctg tcgcccggga aacactagat      2580
     gaagacgagg aggaagtctc cggatgggat atgggtgatg atgtcaatgt tgaggaagag      2640
     gtcgacttcg tcaatgtgga aagcgctgaa gctggtgcgg gcagttctga ggccgatttg      2700
     tgggctcgta actcgccgct ggctgctgat cacgtcgccg ccggctcttt cgacactgcg      2760
     atgcagctct tgaaccgcca agttggtgcc gttcagttcg ctcctctcaa ggctcgcttc      2820
     ctcgaagtct acaaggcgtc taagacatat ctcccggcca ctgctggtct gcctcctttg      2880
     gtcaactatg tgcgccggac cgtcgacgag actgaactcc ggaagatgct tcccatcatt      2940
     ccccgggacc tagagactgt tgccagtgtc gacctgcagg agggttatgc cgctatgcgg      3000
     tccaataaac tggaggatgg tgtagcaacc ttcaagcgca ttcttcacac tgttctcgtt      3060
     aacactgtct catccgaagc cgaggtggag gaggcaaaga agatcattgc cactgcccgg      3120
     gaatacattc tcgccatgtc gatcgagctc gagcgccgtt ctctcaccac cgactcccct      3180
     gacaacctca agcgcagcct tgagctgtcc gcctacttca caatccccaa gctcgaggtc      3240
     gcccaccgtc aactggcatt gatggcagca atgaagttgg cttttgccaa caagaactac      3300
     ggctcagcct tgagctttgc caaccgcatg ctggccaatg ggggctccgc taagcttttg      3360
     gaacaggcca agaagatcaa ggctcaatgc gagcgcaacc ctcaggacca gatcgatatt      3420
     gacttcgacc ccttcgccga gttcgatatc tgcgcagcct cctacactcc tatctacagc      3480
     ggctctccca gtgtctcaga cccattcacc ggtgccaaat accaccccca gtacaaggga      3540
     agcgtcgacc ggatatcgga tgttacggag attggtgccc cggccagcgg cctgcgcctg      3600
     ttcgtcccca gtcagtttta g                                                3621
//

If you have problems or comments...

PBIL Back to PBIL home page