(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE398

PENCW_16.PE398       Location/Qualifiers
FT   CDS_pept        join(complement(913249..913412),complement(912644..913166))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000195924" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20671933"
FT                   /orf_name="Pc20g03980"
FT                   /product="Pc20g03980 protein"
FT                   /function="thiol oxidase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAP85727.1"
FT                   /db_xref="GO:0016972"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="InterPro:IPR006863"
FT                   /db_xref="InterPro:IPR017905"
FT                   /db_xref="UniParc:UPI00018313BA"
FT                   /db_xref="UniProtKB/TrEMBL:B6HH68"
FT                   /transl_table=1
FT                   /translation="MSSVPPEQVNSQYKDMSSMFNQQNPAASASSSKPAGDDSKPPLPK
FT                   GVVLDKDGKPCRTCTSVASWRALTKQADLKSANSNSTSTPTSSTSKMTTPTAGLAAAAT
FT                   PSPSETPSDCPPDVEELGRSTWTLLHSMAATYPEKADAEHQANMSGFLKFFSKLYPCWV
FT                   CADDFRAWMAHPSGRNQPKLGSRKEFGWWMCEAHNEVNRKLGKKEFDCRLWEERWRTGW
FT                   KDGRCD"
     atgtcctcag ttccaccgga gcaagtcaat agtcaatata aagacatgag ttccatgttc        60
     aaccagcaaa accccgccgc ctccgcaagt tcctcgaaac cagccggaga tgactcgaaa       120
     cccccattgc ccaagggcgt agtcctggac aaggatggaa agccctgccg cacctgcacc       180
     tccgtcgcct catggcgagc attgaccaag caagccgacc tcaaaagcgc aaactcgaac       240
     tctacctcaa cccccacctc gagcacaagc aaaatgacaa ccccaacggc cggcctcgcc       300
     gctgccgcaa ccccctcccc cagcgaaaca ccctcagact gtccgccaga cgttgaagaa       360
     ctaggccgct caacatggac actactgcac tcgatggccg ccacatatcc cgaaaaggca       420
     gacgcggaac accaggccaa tatgagcggg ttcttgaagt tcttctcaaa gctgtacccg       480
     tgctgggtgt gcgcggatga tttccgggca tggatggcgc atccgagtgg acggaaccag       540
     ccgaaactgg ggagtcggaa ggagtttgga tggtggatgt gcgaggcgca taatgaggtt       600
     aatcggaagc ttgggaagaa ggagtttgat tgtcggttgt gggaggagag gtggcggact       660
     gggtggaagg atggtcggtg tgattga                                           687
//

If you have problems or comments...

PBIL Back to PBIL home page