(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE399

PENCW_16.PE399       Location/Qualifiers
FT   CDS_pept        join(913917..914180,914387..915223)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000195925" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948902"
FT                   /orf_name="Pc20g03990"
FT                   /product="Pc20g03990 protein"
FT                   /protein_id="CAP85728.1"
FT                   /db_xref="UniParc:UPI00018313BB"
FT                   /db_xref="UniProtKB/TrEMBL:B6HH69"
FT                   /transl_table=1
FT                   /translation="MPPKYTMFTMSDSESEAEREVSNIPSDQVLEKTLRDQVATIFKSG
FT                   NMEELTVKRVRLAAEDTLGLTAGYFKSTGDWKARSENIIKDEVRQKTRTPVSDEEEELS
FT                   VPPSDESDRVTKPKKRSKAPVNKSPVKASVQKPKKDTSDASDFSGDESEEVTMPKKRSK
FT                   APVKKSPTKKPSVHKPMKDISDASDVPHDTSDVAKETRDTKDDSESEMSVVLDEEPQPK
FT                   APRKRQKSAGGTATKTKKKAPKAKDEDISPDQAEIRRLQGWLVKCGIRKLWGKELAPYD
FT                   TPKAKIKHLKKMLEDAGMTGRPSQEKANQIREERELKADLEQIQEGAKQWGAKSDEEDE
FT                   DAKPRRRLARGRQSLAFLESDGEETD"
     atgccgccga agtatacaat gtttacaatg tccgactctg agtctgaagc tgagagagag        60
     gtgtccaaca ttccctctga ccaggttctt gagaagacac ttcgcgacca ggtagctaca       120
     atctttaagt caggaaacat ggaggaattg accgtgaagc gcgtacgact cgccgcggaa       180
     gatacactag gtctcacagc agggtacttt aagtctacgg gcgactggaa agcgcggagt       240
     gagaatataa tcaaggatga ggtgcgtcag aagactagga cgccggtgtc cgatgaggaa       300
     gaggagctat cagttccgcc gtctgacgag agtgacaggg tcacaaagcc caagaaacga       360
     tcgaaagcgc cagtcaataa gtcaccagtg aaggcctccg tacagaaacc caagaaagat       420
     acgtcagatg cttctgattt ctccggtgat gagagtgagg aggtcacaat gcccaagaaa       480
     cgatcgaaag cgccagtgaa gaagtcccca acgaagaagc cctccgttca caaacccatg       540
     aaagatatat cagacgcttc cgatgttccc catgacactt cagacgtcgc caaagagacc       600
     agggacacca aggacgattc cgaaagcgag atgtcggttg tgcttgacga agagcctcag       660
     cccaaggccc cacgcaagcg acagaagagt gccgggggaa ctgcgaccaa gaccaagaag       720
     aaagctccca aagccaagga tgaggatatc agcccggacc aggctgaaat cagacggctg       780
     caaggatggc ttgtcaaatg tggaatccgt aagctgtggg gtaaagaact ggcgccatat       840
     gataccccca aagccaaaat caagcatctc aagaagatgc tggaggatgc tggaatgact       900
     ggccggccat ctcaagagaa ggcaaaccag atccgcgaag aacgggagtt gaaagcggat       960
     ctagagcaga tccaagaggg cgcaaaacaa tggggtgcca agagtgacga ggaggacgag      1020
     gatgcgaagc ctcggcgtag gctggctcgg gggcgacagt cgcttgcatt cttagagagt      1080
     gatggcgaag agacagattg a                                                1101
//

If you have problems or comments...

PBIL Back to PBIL home page