(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE400

PENCW_16.PE400       Location/Qualifiers
FT   CDS_pept        join(915969..916045,916120..916140,916217..916348,
FT                   916411..917048,917101..917669,917722..918083,9
FT                   18136..918565)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000163270" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948903"
FT                   /orf_name="Pc20g04000"
FT                   /product="Pc20g04000 protein"
FT                   /function="binding"
FT                   /function="protein transporter activity"
FT                   /biological_process="intracellular protein transport "
FT                   /biological_process="vesicle-mediated transport "
FT                   /cellular_component="membrane coat"
FT                   /protein_id="CAP85729.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0006886"
FT                   /db_xref="GO:0008565"
FT                   /db_xref="GO:0016192"
FT                   /db_xref="GO:0030117"
FT                   /db_xref="InterPro:IPR002553"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR016342"
FT                   /db_xref="UniParc:UPI00018313BC"
FT                   /db_xref="UniProtKB/TrEMBL:B6HH70"
FT                   /transl_table=1
FT                   /translation="MAMNKIRGAFTVPRKGETFELRAGLVSQYAYERKESIQKTIMAMT
FT                   LGKDVSALFPDVLKNIATGDLEQKKLVYLYLMNYAKSHPDLCILAVNTFVQDSEDPNPL
FT                   IRALAIRTMGCIRVDKMVDYMEEPLRKTLRDESPYVRKTAAICVAKLFDLNPAMALENG
FT                   FLEMLQEMIGDPNPMVVANSVTALQEIHHTAPETQALQITSNTLRKMLMALNECTEWGR
FT                   VTILTTLAEYKTSDVKESEHICERVAPQFQHVNSGVVLAAVKAVFLHMKNVNPDLSKNY
FT                   LKKMAPPLVTLVSSAPEVQYVALRNIDLLLQKEPDILNKELRVFFCKYNDPPYVKFQKL
FT                   EIMVRIANDRNVDQLLAELKEYALEVDMDFVRRAVRAIGQVAIKIESASERCVNTLLDL
FT                   INTKVNYVVQEAIVVIKDIFRKYPGYEGIIPTLCQCIDELDEPNARAALIWIVGEYAEK
FT                   ISNAGDILGGFVDGFNEEFSSTQLQILTAVVKLFLKRPEKAQGLVQRVLQAATSENDNP
FT                   DVRDRAYIYWRLLSNTSDSNATKNIVLSDKPPIVTTIHSLPPSLLDQLLSELSTLSSVY
FT                   HKPPEQFVGHGRFGADAVMRAAIEEQLQNARENPLAAAAAAAAGGTTAPAQAQNNVENL
FT                   LDIDFDGGAPASAQTEPSSGMSGLEGLAGTPVRVASPAAGTTTGQASNNLDDLLGVFGD
FT                   SGAAQPSSSGANSGDLMNGFSGLDLSGNAGPSQNTQTKKSNDDILSLF"
     atggcgatga acaagatccg tggcgccttc acggtgcctc ggaaaggaga aacgttcgaa        60
     ttgcgagctg gacttgtttc ccagtatgcc tacgaacgga aggaatccat tcaaaagaca       120
     atcatggcca tgaccctagg aaaggatgtt tcggccttgt tcccagatgt tctcaagaat       180
     attgctacag gagatctgga gcagaagaaa ttggtctacc tctatctcat gaactacgcc       240
     aaatcgcacc ctgatctatg tattctcgcc gttaacacct tcgtacaaga ttcggaagac       300
     cctaacccac tgattcgtgc gctggcaatc cggacaatgg gttgtattcg ggtggacaag       360
     atggtggact acatggaaga accactgcgc aagacactcc gagatgagtc gccatatgtc       420
     cgcaagaccg ctgcaatctg tgtcgccaag cttttcgatc taaacccggc aatggctctc       480
     gagaacggat tcttggagat gctccaggag atgattgggg accccaaccc catggtcgtc       540
     gccaattcag tgaccgcact tcaggagatc catcacacgg cacccgaaac acaggctttg       600
     cagattacta gtaacactct acggaagatg ctgatggctt tgaatgagtg cacggaatgg       660
     gggcgcgtca ctattctcac aactttggcc gagtataaga cctccgacgt gaaggagtcc       720
     gaacacattt gcgaacgggt cgctcctcag ttccagcatg ttaactccgg tgtggttctt       780
     gctgcagtca aggctgtttt cctgcatatg aagaatgtca acccggactt gtcgaagaac       840
     tacctaaaga agatggctcc gccattggtt acattggttt cgtcagctcc cgaagtgcaa       900
     tacgtcgcat taagaaatat cgaccttctg ctgcagaagg agcctgacat cctcaacaaa       960
     gaactccgcg ttttcttctg caaatacaat gacccgccat atgtcaagtt ccagaaactt      1020
     gagattatgg tgcgcatagc gaacgaccgc aatgtggatc agctcctcgc tgaattgaag      1080
     gagtatgccc ttgaagtcga tatggacttt gtccgccgag ctgtcagggc aatcggccag      1140
     gtcgccatca agatcgagag cgccagcgag cggtgtgtta acacgttgtt ggatctcatc      1200
     aacaccaagg tgaactacgt cgttcaggaa gcgatcgttg tcatcaagga catcttccgg      1260
     aaatatcctg gctacgaagg tatcatcccg actctgtgcc agtgcattga tgagttggat      1320
     gagcctaatg ctagagcggc cctcatctgg attgttggag aatatgccga gaaaattagc      1380
     aacgccggtg atatcttggg tggctttgtg gatggtttca acgaagaatt ctcttcgacc      1440
     caattgcaaa tcctcacagc tgtggtaaaa ctcttcctca agcgacctga gaaggcacaa      1500
     ggcctggtgc agcgagtact ccaggctgcg acctccgaga acgacaaccc agatgtccgt      1560
     gaccgggcat atatttactg gcgtcttttg tccaacacta gcgattcaaa cgcgacaaag      1620
     aacatcgtgc tatcggacaa gcctcctatc gtcaccacca tccactcact gccaccgtcg      1680
     ctcctcgacc aactcctttc cgaactgtct actctctctt ccgtctacca caagcccccc      1740
     gaacagtttg tcggccacgg ccgattcggc gccgatgccg tcatgcgcgc tgctatcgag      1800
     gaacaactcc agaacgcgcg cgagaaccca ttggctgcgg ctgctgcggc tgctgctggc      1860
     ggcaccacgg cccctgcgca ggcgcaaaac aacgtcgaga acctgctgga catcgatttc      1920
     gacggcggtg ctcctgcctc cgcacagacc gagccttcaa gcggtatgtc cggcctggag      1980
     ggtctggctg gcacccccgt acgggtagca tcccctgcag ctggtacaac cacggggcaa      2040
     gccagcaaca acctggatga tcttttgggc gtgttcggag actctggtgc tgcccagccc      2100
     tcctcgagcg gtgccaacag cggtgatctc atgaacggat tctcaggtct tgatctctcc      2160
     ggaaatgcgg gtccttctca aaatacccag accaagaaat ccaacgacga catcttgtcg      2220
     ctcttctag                                                              2229
//

If you have problems or comments...

PBIL Back to PBIL home page