(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE401

PENCW_16.PE401       Location/Qualifiers
FT   CDS_pept        join(919345..919521,919620..920522)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000294667" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948904"
FT                   /orf_name="Pc20g04010"
FT                   /product="Pc20g04010 protein"
FT                   /function="oxidoreductase activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAP85730.1"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="InterPro:IPR002085"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI00018313BD"
FT                   /db_xref="UniProtKB/TrEMBL:B6HD86"
FT                   /transl_table=1
FT                   /translation="MAQTDYKFEGWMGLDPSAAEGKMVWQEFQPKEWEETDVDIKVTHC
FT                   GICGSDIHTLRSGWRPTAYPCCVGHEIVGTAVRVGSKVSGGIQIGDRVGVGAQSESCLG
FT                   RLGDCEECASGQENYCSKKVVGTYNSIHYDGSKSYGGYARYHRVPGHFAIKIPSAIPSA
FT                   DAAPMLCGGATLYSPLKHNGCGPGKRVGIIGVGGLGHFGLLFAKAMGADKVVAISRKMG
FT                   KKEDSLKMGADLYIATDDEPDWATVNARSLDLIVSTVSSTKMPFNDYLGLLKTGGSFVQ
FT                   VGLPEDGGLFAPVRSLMRRLKLQSSLVGSPNEIREMFQLVSEKGIRPWVQEIPMKDANK
FT                   AIVDMEDGKARYRYVLVNE"
     atggcgcaaa cagactacaa attcgaaggc tggatgggtc tcgaccctag tgccgccgag        60
     ggcaagatgg tctggcaaga attccagccg aaagagtggg aggagaccga tgttgatatc       120
     aaggtcactc actgtggtat ctgtggttcc gatatacaca ctctgcggag tggctggaga       180
     cccaccgcct acccctgctg cgtgggccac gagattgtcg gcacagccgt gcgcgtgggt       240
     agcaaggtat ccggcggcat ccagatcggc gaccgcgtcg gtgtcggcgc acagagcgag       300
     tcctgcctcg gccgtctagg cgactgcgag gagtgcgcat caggccagga gaactactgc       360
     agcaagaagg ttgtcggcac gtacaacagc atccactacg acggcagtaa gtcgtacggc       420
     gggtatgcgc ggtaccaccg tgtccccgga cattttgcta tcaagatccc cagtgccatc       480
     ccatcggctg atgctgcgcc tatgctgtgc ggcggcgcca ccctctacag cccgcttaag       540
     cacaatggct gtggtcctgg caagcgcgtg ggcattattg gtgttggggg actgggtcac       600
     tttggcttgt tgtttgctaa ggctatgggg gctgataagg tggttgccat ctcgcggaag       660
     atggggaaga aggaggactc gctgaagatg ggggcggacc tttatattgc gactgatgac       720
     gagccggact gggctacggt taatgctcgg tctttggatt tgattgtttc cactgtctcg       780
     tctactaaga tgccttttaa tgactacctg ggtctgctga agaccggtgg atcttttgtg       840
     caggttggtc ttcctgagga cggtgggctg ttcgctcctg ttcggagctt gatgcgtcgc       900
     ctgaagctgc agagctccct tgttggtagc cctaacgaga tccgggagat gttccagctt       960
     gtttctgaaa agggaattcg cccgtgggtg caggagatcc cgatgaagga tgcgaataag      1020
     gcgattgtgg atatggagga tggaaaggcc cgctacagat acgtgctggt caatgagtag      1080
//

If you have problems or comments...

PBIL Back to PBIL home page