(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE402

PENCW_16.PE402       Location/Qualifiers
FT   CDS_pept        join(920780..920833,920898..922457)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000230745" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20671934"
FT                   /orf_name="Pc20g04020"
FT                   /product="Pc20g04020 protein"
FT                   /EC_number="4.2.3.1"
FT                   /function="pyridoxal phosphate binding"
FT                   /function="threonine synthase activity"
FT                   /biological_process="threonine biosynthetic process "
FT                   /protein_id="CAP85731.1"
FT                   /db_xref="GO:0004795"
FT                   /db_xref="GO:0009088"
FT                   /db_xref="GO:0030170"
FT                   /db_xref="InterPro:IPR000634"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR004450"
FT                   /db_xref="UniParc:UPI00018313BE"
FT                   /db_xref="UniProtKB/TrEMBL:B6HD87"
FT                   /transl_table=1
FT                   /translation="MSPTLSQQYLSTRGAEYGRTFEDVVLQGLASDGGLFIPEEMPTLP
FT                   KSWETEWRDLSFEDLALEIMSLYISTDEIPREDLKNIIYKSYSTFRHPERTPSVLLEKN
FT                   LYLLELFHGPTFAFKDVALSFLGNLFEYFLVRKNAGKTGKDRHHLTVVGATSGDTGSAA
FT                   IYGLRGKKDVSVFILFPDGGRVSPIQEKQMTTILDPNVHNLTVAGSFDHCQDIVKSLFA
FT                   DEDLNSTHNIAAVNSINMARILAQITYFIYSYFALTKTPSFNKDSKVRVVVPSGNFGDI
FT                   LAGWFAKSMGLPIEKLVIATNANDILDRFFRSGGHYTKKALDAPTDHGVKETHSPAMDI
FT                   LVSSNFERLLWFLSYQTTSGTEADRRKHACESVSGWLNELKTNGGFQVPSEVLEAAKVD
FT                   FESERVSNEETIAMIRDIYKTSFPKGLGPGSAKSSKTGGYILDPHTAVGVAATRRSMAR
FT                   NPDATHISLSTAHPAKFAGAVDLALRGEDGYDFTEILPQEFIGLEQRESRVTPVGESAG
FT                   WQGVKEIVKAELEQELQGLR"
     atgtctccta ctctctcaca acaatatcta agtacccgtg gtgccgagta cgggagaacc        60
     tttgaagatg ttgttctcca aggcttggcc tccgacgggg gtctctttat cccggaggaa       120
     atgcctaccc tccctaagtc atgggagacc gaatggcgcg atctgagctt cgaggatttg       180
     gcgctcgaaa tcatgtcact ctatatctct acggacgaga ttccccgtga agatctcaag       240
     aacattatct acaagtccta ctcgactttc cgtcaccccg agcgcactcc ttccgtcctc       300
     ctggaaaaga acctctacct cctcgagcta ttccacggcc cgacctttgc gttcaaggat       360
     gttgcgctaa gtttcctcgg aaacctgttc gagtatttcc tcgtccgaaa gaatgctgga       420
     aagactggca aggatagaca ccacctgacc gttgtcggtg ctactagcgg tgacactggg       480
     tcagctgcta tctatggact ccgcggcaag aaggatgtct ccgtgttcat tcttttccct       540
     gatggtggcc gagtctcgcc tatccaagaa aagcaaatga ctaccatctt ggaccccaat       600
     gttcacaacc tcactgtggc tggatcgttc gatcactgcc aggatatcgt caaatcactc       660
     ttcgctgatg aagaccttaa ctccacccac aacatcgccg ccgtcaacag cattaatatg       720
     gccagaattc tggcccagat cacctacttc atctactcct actttgccct caccaagacc       780
     ccctctttta acaaggattc taaggtccga gtcgtcgtcc cgtccggcaa cttcggcgat       840
     atccttgccg gttggttcgc caagtcgatg ggtcttccca tcgagaaact ggtgatcgcc       900
     accaacgcaa atgacattct cgaccgcttc ttccgcagtg gcggccacta caccaagaag       960
     gccctcgacg cccccaccga ccacggcgtg aaggaaaccc acagtccagc catggacatc      1020
     ctcgtcagca gcaacttcga gcgtctcctc tggttcctat cctaccaaac caccagcggc      1080
     accgaagccg atcgccgcaa gcacgcctgt gagagcgtca gcgggtggct aaacgagctt      1140
     aagacgaacg gcggcttcca agtccccagc gaggtcctcg aagccgccaa ggttgatttc      1200
     gagagtgagc gcgtcagcaa cgaggagacc atcgctatga tccgtgatat ctacaagaca      1260
     tctttcccta aaggtcttgg ccccggttct gccaagagct ccaagaccgg tggttacatc      1320
     ctcgaccccc acactgccgt tggtgttgct gccacgcgcc gctctatggc gcgcaatccc      1380
     gatgccaccc atatctcctt gtccactgcc cacccggcta agtttgctgg cgctgtggac      1440
     cttgctctgc gtggcgagga tggttatgac ttcaccgaga tcctgcccca ggagttcatt      1500
     ggtctagagc agcgtgagag tcgggttacc ccagtcggtg agagtgccgg atggcagggt      1560
     gttaaggaga ttgtcaaggc ggagcttgaa caagagcttc agggtttgcg gtag            1614
//

If you have problems or comments...

PBIL Back to PBIL home page