(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE403

PENCW_16.PE403       Location/Qualifiers
FT   CDS_pept        join(complement(924407..924678),complement(924086..924331),
FT                   complement(923956..924025),complement(922839..923894))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000200122" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948905"
FT                   /orf_name="Pc20g04030"
FT                   /product="Pc20g04030 protein"
FT                   /function="substrate-specific transmembrane transporter
FT                   activity"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAP85732.1"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0022891"
FT                   /db_xref="InterPro:IPR003663"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI0001831497"
FT                   /db_xref="UniProtKB/TrEMBL:B6HD88"
FT                   /transl_table=1
FT                   /translation="MAGGAAINVFKFNTGGLPKETLNFKLWFAVFAFGLMGAARGVDEG
FT                   LITGVFNSHAFKRSVGIDDLDKDDLASVKGTISSMVQLGSVAGALLAFIVCDRIGRVWA
FT                   TRQLCVLWILGIAIFIGNNGNMAAVYAGRFIAGLGIGQTCVVGPIYLSEISPAPIRGLC
FT                   TCMFTGAVYLGIMIAYFANWGTQIHMADTFNRWAVPTSLHLMFAGIILLLTFFQLESPR
FT                   FYIKQGKREKALEVLCKLRGLPAHHPYVLNEISEMDVAYQEEMEATLGMGWKGLFKEIL
FT                   GIKRNAYRLFLTNLAQNMACWSGGSAITVYAPDLFTLVGITGQEQSLFSTVVFGVVKFV
FT                   AAIICALFLVDMAGRKRSLIIGIVIQTVAMFYIAIFLNLVPIAENPDFVPSETQNRAST
FT                   AAIAFIYISGVGWALGWNSGQYLLSSELFPLRIRGICSSITMAMHFICQYAVNRVLPEM
FT                   LLEDTGLGPHGTFYFFGVISIVGGIWVWLFVPEAAGRSLETIDKMFDLPWYKIGLYGRK
FT                   FAEEYDREQEAIYRDEKRDAGIVVSHNETA"
     atggcgggtg gtgctgctat caacgtcttc aagttcaaca caggcggctt gcccaaggag        60
     acactcaatt tcaagctatg gttcgccgtc tttgcattcg gtctcatggg tgccgcccgt       120
     ggtgttgacg aaggtctcat cacgggtgtc ttcaactccc acgctttcaa gcggtctgtc       180
     ggtattgacg acctcgacaa agatgatctc gctagtgtca agggtactat ttcctccatg       240
     gttcagctcg gcagtgtcgc cggtgctctt cttgctttca tcgtttgtga tcgtatcggt       300
     cgtgtttggg ctactcgcca actctgtgtc ctctggattc ttggaattgc catctttatt       360
     ggaaacaatg gcaacatggc tgccgtctac gctggtcgct tcattgctgg tcttggtatt       420
     ggacagactt gcgtcgtcgg cccgatctac ctttctgaaa tttctcccgc tcccattcgt       480
     ggtctctgta cttgtatgtt tactggtgca gtgtaccttg gtatcatgat tgcctacttc       540
     gccaactggg gtactcagat tcacatggcg gataccttca accgctgggc cgtccctact       600
     tcactccacc tcatgtttgc cggcatcatc ctgctcctca ccttcttcca gctggagtcc       660
     ccccgtttct acatcaaaca gggcaaacgc gagaaagccc tcgaggtcct ctgcaagctc       720
     cgtggcctac ccgcccacca cccatacgtc ctgaacgaga tctccgaaat ggacgtcgcc       780
     taccaggaag agatggaggc cacgctcggc atgggctgga agggtctatt caaggagatc       840
     ctgggcatca aacgcaacgc gtaccgtcta ttcctcacca acctggctca gaacatggcc       900
     tgctggtccg gtggctccgc tattacggtg tacgcgcctg acttgttcac tctcgtcggt       960
     atcaccggcc aagagcagtc cctcttctcg accgtcgtct tcggtgtcgt gaaattcgtc      1020
     gccgctatca tctgcgctct cttcttagtc gatatggccg gtcgtaaacg ctctctcatc      1080
     attggtattg tcatccaaac cgttgccatg ttctacatcg ccatcttcct caacctcgtt      1140
     cctatcgccg aaaacccaga cttcgtcccc agtgagacgc agaatcgtgc atcgactgcc      1200
     gccatcgctt tcatctacat ctctggtgtt ggttgggcgc ttggatggaa cagtggtcag      1260
     tacctgctgt cctcggagct gttccctctc cgtattcgtg gtatttgctc gtccatcact      1320
     atggccatgc actttatctg tcagtatgct gtcaaccgtg tcctccctga gatgctgctc      1380
     gaggatacgg gtctcggccc tcatgggaca ttctacttct ttggtgttat ttccattgtt      1440
     ggtggtatct gggtttggct ctttgtgcca gaggctgctg gtcgcagtct cgagaccatc      1500
     gacaagatgt tcgaccttcc ttggtacaag attggtctgt acggaaggaa gtttgctgag      1560
     gagtacgacc gtgaacagga ggcgatttac cgcgacgaga agagggatgc gggaattgtt      1620
     gtctctcaca acgagactgc gtag                                             1644
//

If you have problems or comments...

PBIL Back to PBIL home page