(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE404

PENCW_16.PE404       Location/Qualifiers
FT   CDS_pept        complement(926969..927454)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18977863"
FT                   /orf_name="Pc20g04040"
FT                   /product="Putative uncharacterized protein Pc20g04040 "
FT                   /protein_id="CAP85733.1"
FT                   /db_xref="UniParc:UPI0001831498"
FT                   /db_xref="UniProtKB/TrEMBL:B6HD89"
FT                   /transl_table=1
FT                   /translation="MADDVFEIKLFCASRFAPPSMTKMIDRGSIWTRAVSTVELLTETF
FT                   QLSPQFHPCSANIDLLSFTTIIYGDELRHKRGDSSNTQFSRCIVGSLINIVKYLFPSFV
FT                   GPRDVPDSSTLEWASMLRLRQESLTELAEELYNHLRGGGEQSLRLAPNTIMELEDIE"
     atggcagatg acgtattcga aatcaagcta ttctgtgctt cccgatttgc ccctccttca        60
     atgacaaaaa tgattgatag gggatcgatt tggacccgtg cggtcagcac ggtcgagctc       120
     ttgaccgaga cttttcagct cagccctcag ttccaccctt gttcagccaa catagacctt       180
     ctatccttca ctactataat atatggtgat gagcttcgac ataaacgtgg tgacagttcc       240
     aacacgcaat tttcaagatg catagttggc tcgctaatca atatcgtgaa gtatcttttc       300
     ccgagctttg tcggcccaag ggacgtgccc gactctagca ctcttgagtg ggcctccatg       360
     ttgcggctcc gccaagaatc tctcaccgaa ttagctgagg agctatataa tcatttacgg       420
     ggaggtgggg agcagtcgtt gaggctagcc cccaacacca taatggagct ggaagatata       480
     gaatag                                                                  486
//

If you have problems or comments...

PBIL Back to PBIL home page