(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE405

PENCW_16.PE405       Location/Qualifiers
FT   CDS_pept        join(complement(928782..928794),complement(928631..928731),
FT                   complement(928437..928571),complement(928245..928379))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000171591" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948906"
FT                   /orf_name="Pc20g04050"
FT                   /product="Pc20g04050 protein"
FT                   /function="actin binding"
FT                   /biological_process="actin cytoskeleton organization "
FT                   /cellular_component="actin cytoskeleton"
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="CAP85734.1"
FT                   /db_xref="GO:0003779"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0015629"
FT                   /db_xref="GO:0030036"
FT                   /db_xref="InterPro:IPR002097"
FT                   /db_xref="InterPro:IPR005455"
FT                   /db_xref="UniParc:UPI0001831499"
FT                   /db_xref="UniProtKB/TrEMBL:B6HD90"
FT                   /transl_table=1
FT                   /translation="MSWQGWVDQTLVGSKKVDKAAIFSAGGDALLATSAGFNVQLEEVQ
FT                   YMLRGFEDSIPLYSGGLYVAGERLMVTKADDQSIYAEKGKEGVCVVRSSQSIIVAHYPE
FT                   TVQSREAASIVGQLANYLTSIGY"
     atgagctggc aaggatgggt cgatcaaacc ctggtgggat ctaaaaaagt cgacaaagcg        60
     gctatattct cagcaggagg cgatgctcta cttgcaacga gtgcaggatt caacgttcaa       120
     ttagaggaag tccagtatat gttgagaggc ttcgaggatt caatccctct atactctggt       180
     ggactctacg tcgcaggaga aagacttatg gtcaccaaag cagatgacca gagcatatat       240
     gctgagaagg gcaaagaggg tgtttgtgtg gtgagatcat cgcaatcaat aattgtcgca       300
     cattaccctg aaacagtgca gtctagagaa gctgcaagca ttgttgggca gttggcaaat       360
     tatctgacta gcataggata ctag                                              384
//

If you have problems or comments...

PBIL Back to PBIL home page