(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE406

PENCW_16.PE406       Location/Qualifiers
FT   CDS_pept        join(complement(930605..931091),complement(929509..930542))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18128997"
FT                   /orf_name="Pc20g04060"
FT                   /product="Pc20g04060 protein"
FT                   /protein_id="CAP85735.1"
FT                   /db_xref="UniParc:UPI000183149A"
FT                   /db_xref="UniProtKB/TrEMBL:B6HD91"
FT                   /transl_table=1
FT                   /translation="MVNSVAILALASPAFAGIMQARGEQFVRPAAQSSAAVAAPAHAEG
FT                   WGESWSKPAEHVSTHDSWSKSTESWTTPCTTSTTTPVHHHTTTTPVHSDTTTPVHSNTT
FT                   TPCTTSTTPVHTTTPVQSNSTTPCTTSTTPVHEHTTKPHVPVKPGTTKTLTYVTTTCPV
FT                   TSSTVTSGSKTWTVPVTGTSTITITKTTVCTMCENEKPVTFHNATQPAPHPTAGPTAPV
FT                   LKPTGDVVIPEKPHHSKPVEPKPVETKPVEPKPVETKPVEPKPVETKPAVPAHSEPAVP
FT                   AHSQPAVPAHSEPAVPAHSEPAVPAHSQPAVPAHSEPAVPAHSQPAVPAHSEPAVPAHS
FT                   EPAVPAHSQPAVPAHSEPAVPAHSQPAVPAHSEPAVPAHSEPAVPAHSQPAVPAHSQPA
FT                   VPAHSQPAVPAHSQPAVPAHSQPAASQPAASKPAASQPAASKPAQSKPAAPKETQPAAN
FT                   PSVPETPETPSKPEEPVSPSSNEFTGAASNVKPVAGLLAGVVGLMALL"
     atggtcaact ccgttgctat tctggctctt gccagcccgg cctttgccgg tatcatgcag        60
     gctcgtggcg agcagttcgt tcgtcccgcc gctcagagct ctgccgctgt cgctgcccct       120
     gcccacgctg agggctgggg cgagagctgg tccaagccgg ccgagcatgt gtcgactcac       180
     gactcctgga gcaagtccac tgagtcgtgg acaaccccgt gcaccacctc gaccaccacc       240
     ccggtgcacc accacaccac gaccaccccg gtgcacagcg acaccactac cccggtgcac       300
     agcaacacca ccaccccgtg caccacctcg accaccccgg tgcacaccac caccccggtc       360
     cagagtaaca gcaccacccc ttgcaccacc tcgaccaccc cggttcacga gcacaccact       420
     aagcctcacg tccccgtgaa gcctggcacc accaagacgc tcacctatgt gaccaccacc       480
     tgccctgtca cctcgtctac cgtcacctct ggctctaaga cctggactgt tcccgtcacc       540
     ggaacaagca ccatcaccat caccaagact accgtctgca ccatgtgcga gaatgagaag       600
     cctgtgacct tccacaatgc tactcagccc gccccccacc ccaccgcagg ccccaccgcc       660
     cctgtcctga agcccaccgg agatgtcgtg attcctgaga agcctcacca ctccaagcct       720
     gttgagccca agcctgtcga gaccaagcct gttgagccta agcccgtcga gaccaagcct       780
     gttgagccta agcccgttga gaccaagcct gctgtccccg ctcactccga gcctgctgtc       840
     cccgctcact ctcagcctgc tgtccctgct cactctgagc ctgctgtccc cgcccactct       900
     gagcctgctg tccctgctca ctctcagcct gctgtccctg ctcactctga gcctgctgtc       960
     cccgctcact ctcagcctgc tgtccctgct cactctgagc ctgctgtccc cgcccactct      1020
     gagcctgctg tccctgctca ctctcagcct gctgtccctg ctcactctga gcccgctgtc      1080
     cccgctcact ctcagcctgc tgtccccgcc cactctgagc ccgctgtccc cgctcactct      1140
     gagcctgctg ttcccgccca ctctcagcct gctgtccccg cccactctca gcctgctgtc      1200
     cccgctcact ctcagcctgc tgtccccgct cactctcagc ccgctgtccc cgcccactcc      1260
     cagcccgctg cctcccagcc cgctgcctcc aagcccgctg cttcccagcc cgctgcttcc      1320
     aagcctgctc agagcaagcc cgctgccccc aaggagaccc agcccgccgc caacccctcc      1380
     gtccctgaga cccccgagac tccctccaag cctgaggagc ctgtctcccc ctcctccaac      1440
     gagttcaccg gtgctgcctc caacgtcaag cccgttgctg gcctcctcgc tggtgttgtt      1500
     ggtctcatgg ctctcctgta a                                                1521
//

If you have problems or comments...

PBIL Back to PBIL home page