(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE407

PENCW_16.PE407       Location/Qualifiers
FT   CDS_pept        join(932608..932789,932847..933044,933103..934237)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000196041" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948907"
FT                   /orf_name="Pc20g04070"
FT                   /product="Pc20g04070 protein"
FT                   /function="DNA primase activity"
FT                   /biological_process="DNA replication, synthesis of RNA
FT                   primer"
FT                   /protein_id="CAP85736.1"
FT                   /db_xref="GO:0003896"
FT                   /db_xref="GO:0006269"
FT                   /db_xref="InterPro:IPR002755"
FT                   /db_xref="InterPro:IPR014052"
FT                   /db_xref="UniParc:UPI000183149B"
FT                   /db_xref="UniProtKB/TrEMBL:B6HD92"
FT                   /transl_table=1
FT                   /translation="MPHSVSPGSAQNDDEMPDAPPVETSTETNVRLEDMFNDDDDDDEE
FT                   FPASGDVKMESPSKEEPPAPTPSGVDPDIMLAFYQRLFPFRYLFQWLNHGIVPTKDFGN
FT                   REFALTLQNDAYLRYQSYPTADLFRKDILKMNPSRFEIGPVYSTNPRDRKTLRGGQMKP
FT                   VSKELVFDIDLTDYDDIRTCCVKANICAKCWAFVTMSIKVIDTALREDFGFEHILWVYS
FT                   GRRGAHAWVCDPRARNLPDERRRAIAGYLEIVRGGSQSGKKVNIKRPLHPHIVRSLELL
FT                   KHDFARTTLGDQDTFESAEQAERLLSLLPDKTLNESLRRKWDSSPDRASTSKWADIDSL
FT                   AKTGKSSTLNPATLRDAKQDIVLEYTYPRLDAEVSKKMIHLLKSPFVIHPGTGRICVPI
FT                   DPRNAENFDPLSVPTVMSLLAEIDEYDAKHPAGTAEADIPDVEGSAMNGSDIKGGRKVQ
FT                   DYEKTSLKPYIDFFRSFIAALIKEERAGKRERDDNGPAVKADPMEF"
     atgcctcact ccgtgtcacc tggctctgcg cagaatgacg atgagatgcc ggatgcgcct        60
     cccgtcgaga cctcgactga aaccaatgtc agactcgagg atatgttcaa cgacgatgat       120
     gacgatgacg aagagttccc ggcttctgga gatgtgaaga tggaatcacc atcaaaggaa       180
     gagcctccag cacccacgcc ctcgggcgtg gatccggata tcatgctcgc cttctatcaa       240
     cgacttttcc ccttccgata cctattccaa tggctgaatc atggaattgt accaacgaaa       300
     gacttcggaa accgagaatt tgctttgaca ctgcaaaatg acgcctacct ccgataccaa       360
     tcatatccga ctgctgacct gttccggaaa gacatactta agatgaatcc ttctcgtttc       420
     gaaatcggac ctgtctacag taccaaccca cgcgatcgca aaacgctacg aggcggccaa       480
     atgaagccag tctctaagga attggttttc gatatcgatt tgactgatta tgatgacatc       540
     cgtacatgtt gtgtcaaagc taatatctgc gctaagtgct gggcttttgt gacaatgtcc       600
     atcaaggtta tcgacactgc actacgggag gactttgggt ttgaacacat cctctgggtt       660
     tactcgggtc gtcgtggtgc tcacgcctgg gtgtgcgatc cccgtgcacg caatctaccg       720
     gatgaacggc gccgagccat tgctggttat cttgagatcg tccgcggagg gtcacaaagc       780
     gggaagaaag tcaacattaa acggccacta cacccccata ttgtacgaag tcttgagttg       840
     ctcaaacacg actttgcccg gaccacactc ggtgaccaag atacatttga atccgctgag       900
     caggcagaac gccttctgtc cttgttgccc gacaagacat tgaacgaatc cctacggagg       960
     aaatgggact cctctccaga tcgtgccagc accagcaaat gggccgatat agattcactc      1020
     gcaaagacgg gtaagagcag cacgctcaac ccggcgactc tccgagatgc gaagcaagat      1080
     attgtcttgg aatataccta cccacgcctg gatgctgagg tcagcaagaa gatgattcac      1140
     ttgctcaaga gtccatttgt tattcaccct ggcactggcc ggatttgtgt tcccatcgat      1200
     cctcgcaatg ccgaaaactt cgatcctctc tccgtcccga cggtaatgag tctgcttgct      1260
     gaaattgatg aatacgacgc gaaacaccct gccggcacag cagaggcaga tattcctgat      1320
     gttgaaggca gtgcgatgaa tggctctgac attaagggtg gccgtaaggt gcaggattat      1380
     gaaaagacta gcctgaagcc ttatatcgat ttcttccgtt ccttcatcgc agctctcatt      1440
     aaggaagagc gtgctggcaa gcgtgaacgc gacgacaatg gccctgctgt caaggccgat      1500
     cctatggaat tttaa                                                       1515
//

If you have problems or comments...

PBIL Back to PBIL home page