(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE411

PENCW_16.PE411       Location/Qualifiers
FT   CDS_pept        join(complement(940279..940478),complement(939931..940128),
FT                   complement(939783..939843))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19824646"
FT                   /orf_name="Pc20g04110"
FT                   /product="Putative uncharacterized protein Pc20g04110 "
FT                   /protein_id="CAP85740.1"
FT                   /db_xref="UniParc:UPI000183149F"
FT                   /db_xref="UniProtKB/TrEMBL:B6HD96"
FT                   /transl_table=1
FT                   /translation="MTTSGSNSCTFLLTRFSVSEKELPELNAITQLNWTPVAHLLLVRV
FT                   IGTTGESKSRSLEWNVDEECGCTGGKYMKDRECVEGMEQKEGISAGTKLNVKLIDRFSE
FT                   SLWRLGMRQEYTKSRRLGQPLLFTVPLPRADLDNLRPTAISHAIHPAS"
     atgaccacct cggggtcaaa ctcctgcact tttttgttga ctcgcttctc ggtctccgag        60
     aaggagttgc ctgaactgaa tgcaatcaca caactcaatt ggacaccagt ggcgcacttg       120
     ttgcttgttc gtgtgattgg gacgacgggc gaatcgaaat cgagatcgtt ggaatggaat       180
     gtagatgaag aatgtggatg tacaggtggg aagtatatga aagacaggga atgtgtagaa       240
     ggaatggagc agaaagaagg gatttcagct ggcacaaaac tcaacgtcaa gctaatcgac       300
     agattctccg aatctctctg gaggctgggg atgaggcaag agtatacgaa atctaggagg       360
     ctgggccaac cgctcttgtt tactgtcccg cttccccgtg cagatctcga taaccttcgc       420
     cccactgcga taagccacgc gattcaccca gcctcttag                              459
//

If you have problems or comments...

PBIL Back to PBIL home page