(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE412

PENCW_16.PE412       Location/Qualifiers
FT   CDS_pept        join(940490..940520,940581..940649,940706..941033,
FT                   941084..941462)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000196076" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948911"
FT                   /orf_name="Pc20g04120"
FT                   /product="Pc20g04120 protein"
FT                   /protein_id="CAP85741.1"
FT                   /db_xref="InterPro:IPR016509"
FT                   /db_xref="UniParc:UPI00018314A0"
FT                   /db_xref="UniProtKB/TrEMBL:B6HD97"
FT                   /transl_table=1
FT                   /translation="MAVPFAQRWARFVPVVGYHHVLMIIVAVAIILLSLLLAGCSSSSP
FT                   QIPDIFLISLYYERYNPIMDLAQVQPDVASPISHIVGGAEMEVRVGYFGICVQPDKGSF
FT                   ICNANATALAEIVTVDQDPMNLIWVASTFKDAVVFPYLLIVAVILAFFCFILLATFPGW
FT                   HEELNEDGSDHEVKPFPSRAVSQAALALIFVASVFVLVSVLWQHTASVAASTIAQDMGN
FT                   GSVKSGVGASAMVLGWFGFVLLVIVTVGLLFMILSIRLITKMTDDE"
     atggctgttc cctttgccca aagatgggcc cggttcgttc cagtggtcgg gtaccaccac        60
     gtgttgatga ttatcgtagc agttgctatt atcctattat cacttctgtt ggccggctgc       120
     tcttcctcat ccccacagat ccctgacatc ttccttatct ctctatacta tgaaaggtat       180
     aaccccatta tggacctcgc acaagtccaa ccagatgtgg cgagtccgat ctcccacatc       240
     gtcggcggcg cagagatgga agtccgggtg gggtactttg gtatctgtgt tcagcctgat       300
     aaaggttctt tcatttgcaa cgccaatgcg acggcactgg ctgagattgt cactgtggat       360
     caagatccaa tgaacctgat ctgggttgcc tccacgttca aagacgccgt ggtattcccg       420
     tatctcctga ttgttgctgt cattctcgca ttcttctgtt tcatccttct ggcgacattc       480
     cctggctggc acgaggagct caacgaagat ggatccgatc atgaagtcaa gcctttcccc       540
     tcacgggccg tttcccaggc tgcgctagcc ctcatttttg tcgcctcggt gttcgttctc       600
     gtgtccgttc tctggcagca cacagcgtcg gtcgctgcca gcacaatagc ccaagacatg       660
     ggcaatggaa gtgtaaaaag tggcgtcggc gcttctgcaa tggtgcttgg ctggtttggc       720
     tttgtcctac tagttatagt cactgttggt ttgctgttta tgatcttgag tatacgtctg       780
     atcaccaaaa tgaccgacga cgaataa                                           807
//

If you have problems or comments...

PBIL Back to PBIL home page