(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE413

PENCW_16.PE413       Location/Qualifiers
FT   CDS_pept        join(complement(943836..944136),complement(943551..943735))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18128998"
FT                   /orf_name="Pc20g04130"
FT                   /product="Putative uncharacterized protein Pc20g04130 "
FT                   /protein_id="CAP85742.1"
FT                   /db_xref="UniParc:UPI00018314A1"
FT                   /db_xref="UniProtKB/TrEMBL:B6HD98"
FT                   /transl_table=1
FT                   /translation="MALPSIDHSSSHPGVYLSCFAQISDQRLQGPADHLISTTNQDYGV
FT                   SSGLYAGSSVKSVSGRCIDHAKGTRPEVVQKFVWFWPKSKFPKSSRTQQAASEERASRQ
FT                   ELPMLDINMESTQLHARPSSELMKIVRTVSASREALLGDGARSLLHSMGRSQDPSHD"
     atggctctgc caagcattga tcactcgtca tctcaccctg gcgtctacct gagctgcttc        60
     gcacaaatca gtgatcaacg gcttcagggg ccagctgatc atctgatctc taccactaat       120
     caggactatg gggtttccag tggactgtac gctggatcaa gtgtgaagag tgtttctggg       180
     cgctgtatcg accatgctaa agggacacga ccagaagtag tccaaaagtt cgtttggttc       240
     tggcccaagt ccaagttccc aaagtcctct agaacccagc aagcagctag tgaagagcga       300
     gcaagtcgac aggaactacc gatgctcgat atcaacatgg aatcgaccca gcttcacgct       360
     cgtccttctt cggagttgat gaaaattgtc cgtactgtgt ccgccagccg agaagcacta       420
     ctgggcgacg gagctcgaag tctgttgcat agtatgggtc gttcgcaaga tccgtcacat       480
     gattga                                                                  486
//

If you have problems or comments...

PBIL Back to PBIL home page