(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE415

PENCW_16.PE415       Location/Qualifiers
FT   CDS_pept        join(947624..947825,947880..948706)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000196109" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18978095"
FT                   /orf_name="Pc20g04150"
FT                   /product="Pc20g04150 protein"
FT                   /function="zinc ion binding"
FT                   /protein_id="CAP85744.1"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR018957"
FT                   /db_xref="UniParc:UPI00018314A3"
FT                   /db_xref="UniProtKB/TrEMBL:B6HDA0"
FT                   /transl_table=1
FT                   /translation="MDDVELRQEILQRTLKEVADEEKEAANPCVICLDTIAEPCVAQPC
FT                   HHTNFDFLCLVSWIEQQPKCPLCKIELTAVQYDLNATQGPKLYKLPPPSAAIPAAPASA
FT                   RLRPGNRYGPRGRRPPPLPPPQPDDPLERRRNVYRNQTYSMRVGSNRLSQYRELTPELF
FT                   ARDEGLVSRARKWIRRELRVFSFLNPEPEDVERTSHQVSRPGPQRLENRRANNAEFLLE
FT                   YVIAILRTVDLKGSAGQAEDLLRDFIGRENACLFLHELQAWLRSPYNSLEDWDRHVQYS
FT                   NTPRSTSHGSYRDSDDLGRRSTPVHTRGRPQRFRRPYRSRSQENIDRSRRLQQAQQRYN
FT                   PY"
     atggatgatg tcgaattgcg acaggaaatc ctccagcgga ctcttaaaga ggtagctgat        60
     gaggagaaag aggcagcaaa tccttgtgtt atttgcttag acactatcgc cgagccgtgt       120
     gtggcacagc catgccacca tacgaacttc gacttcctct gccttgtcag ttggattgag       180
     cagcaaccga aatgtccact atgtaaaatc gagttgacag cggtgcaata tgatctcaac       240
     gccacacaag gcccgaagct atacaagctc ccgcccccga gcgcagcaat tcccgcagct       300
     ccagcctctg ctcgattgcg ccccggtaat cgttacggcc cacgagggcg acgtcctcca       360
     cccttgccgc caccacagcc agacgacccg ctcgagcgcc ggcgcaatgt ctatcgcaac       420
     caaacatact cgatgcgagt cggatccaat cggttgtctc agtaccgaga actgacaccg       480
     gaactctttg ctcgtgacga ggggctcgtc tcgcgcgctc ggaagtggat ccgccgtgaa       540
     ctacgagtct tctctttcct gaatccggaa ccggaggacg tagagcggac atctcaccag       600
     gtctcgcgcc ctgggcccca acggctggag aatcgcaggg caaacaatgc cgagtttctg       660
     ctggaatatg tcattgctat cttgcgcacg gttgatctca aaggcagtgc tgggcaggcg       720
     gaggatctgt tgcgtgattt catcggacgc gagaatgcgt gtctgttcct ccatgagtta       780
     caggcgtggt tgaggagtcc ttataattct ttggaggact gggaccgtca tgtgcagtac       840
     tcgaatactc cgcggagtac atcccacgga agctataggg actctgatga cttgggtcgt       900
     agatctactc ctgtgcacac tcgcggtaga ccacagaggt tccgaagacc atacaggtcc       960
     aggtctcagg agaatattga tcgctccagg cggctgcaac aagctcaaca gcgatataat      1020
     ccatactag                                                              1029
//

If you have problems or comments...

PBIL Back to PBIL home page