(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE416

PENCW_16.PE416       Location/Qualifiers
FT   CDS_pept        join(complement(949467..949740),complement(949231..949292))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18978096"
FT                   /orf_name="Pc20g04160"
FT                   /product="Putative uncharacterized protein Pc20g04160 "
FT                   /protein_id="CAP85745.1"
FT                   /db_xref="UniParc:UPI00018314A4"
FT                   /db_xref="UniProtKB/TrEMBL:B6HDA1"
FT                   /transl_table=1
FT                   /translation="MAQPLVPLLGSRGHREECMSLPISTPACLPARLEVIPTPQSQDDR
FT                   AAAPSQLHQAGSEEKTLRKFVGAYKSIIENLDRIEPDIDDLKRLHEHISRKKIGGTRLN
FT                   LTVRGLD"
     atggctcaac cactagtgcc tttgttggga tcaagaggtc atagagaaga gtgcatgagc        60
     ctgcccatct ccactcccgc ctgcttgcct gctcgcctcg aggtaattcc tacaccacaa       120
     agccaggatg accgagcggc agcgccaagc caacttcacc aagccggcag cgaggaaaaa       180
     acactccgca aattcgtagg cgcctataaa agcatcatag aaaacctgga ccgcatagag       240
     ccagacatcg acgatttaaa gcggctacac gaacatatat caaggaagaa gattggtgga       300
     accagactta atttaaccgt gagaggactg gactag                                 336
//

If you have problems or comments...

PBIL Back to PBIL home page