(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE419

PENCW_16.PE419       Location/Qualifiers
FT   CDS_pept        join(complement(955143..955293),complement(953556..955066))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000196120" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20672204"
FT                   /orf_name="Pc20g04190"
FT                   /product="Pc20g04190 protein"
FT                   /protein_id="CAP85748.1"
FT                   /db_xref="InterPro:IPR021110"
FT                   /db_xref="UniParc:UPI00018314A5"
FT                   /db_xref="UniProtKB/TrEMBL:B6HDA3"
FT                   /transl_table=1
FT                   /translation="MADNVLNSSAEIGAQAINVRAELKTWEKAFASANGGRKAGRDDIK
FT                   QNADIAAKYKEYSRLKALEASLSRRENSRQEPYDSHSKKRKHASPPDQDSAYLQVTPRK
FT                   SSRGLFATPSNNRTKHHPAQLDPYDSPSTLRRLFSPSTHRQGLPAPSPLKAAIGPTPQR
FT                   DGKALGLFDMLSESGGSGGTPSATRQSNNLAATFRTPSKRRPVDTIPEVPEVEAQQETP
FT                   RLARTPASETKQFYLANLFATPTTMRYAAMVEADDNPDEQTTNSLNPAPEISAQEAQSG
FT                   TPSFLRRSNSGRYPPPSEKHDGPGLSPIDSRKPQRFASKGLTHLVQGLRDMEEDRMEED
FT                   WEIMREMEEEAEAEEAAKVQVEDSQGPDVNRKYKKKGQKRTTRRVIMRPVIHQPKPKPK
FT                   APPAMNEDPKHEDDVTAVPGTQQQPAANDGWDDVPSDIERADEAASLHTMSEPELDTEA
FT                   EFEPDSDDDPEFGEQPKPVARPKTFSERIKEAVSSSAAKQQEQEPMGKPPKKPSETAEA
FT                   KKPRARKVNPQAHANYRSLSINRGGSSRGRGRFRRK"
     atggccgaca acgttcttaa ttccagtgcc gagattggcg ctcaagctat caacgttcgc        60
     gccgaattga aaacatggga gaaagccttc gcgtcggcca atgggggccg caaagccgga       120
     cgcgatgata tcaaacaaaa cgcggatatc gcggctaaat acaaggagta cagtcgtctc       180
     aaggcccttg aagcatccct aagccgacgc gagaacagcc gacaagagcc gtatgacagt       240
     cactcgaaga agcggaaaca tgcatctccc cctgatcagg atagtgcata tcttcaagtc       300
     acaccccgta aatcatctag aggactcttt gcgactccat ccaacaatcg caccaaacac       360
     caccctgcac aacttgatcc gtatgactcg ccgtcaactc ttcggagact atttagtccc       420
     agtacacatc ggcaagggct cccagcaccg tcaccactca aggccgcaat tgggcctacg       480
     cctcagcgtg atggaaaggc attgggcctg ttcgacatgc tttctgaatc tggtgggagt       540
     ggtggaacac catccgctac gaggcagagt aataacctag ctgccacgtt tcgaacaccc       600
     tcgaaacgaa gacctgtgga cacgatccct gaggtcccgg aagtagaggc tcagcaggag       660
     acgcccaggc ttgcacgaac ccctgcgtct gagaccaaac agttctatct cgcaaatcta       720
     ttcgcgacac cgaccacgat gcgttatgcc gctatggtgg aagcggacga taatccagat       780
     gaacagacga cgaattcgct aaatccggcg cctgaaatct cagcccaaga agcgcagtct       840
     gggacaccat ctttcctccg tcgctccaac tctggtcgat atcctccacc tagcgaaaag       900
     catgatggtc ctggactcag tcctattgat tcacgcaagc cgcaaaggtt tgccagcaag       960
     gggctaacgc atttggtcca aggactgcgg gacatggaag aggatcgtat ggaagaagac      1020
     tgggagatca tgcgcgagat ggaggaggag gcagaggcgg aagaagcggc caaggtccag      1080
     gtcgaggata gtcaaggacc ggacgtgaac cggaaataca agaagaaggg acagaagcga      1140
     acgacgcgaa gagtgatcat gagaccagtt attcatcagc cgaagcccaa accaaaggcc      1200
     cctcctgcga tgaatgagga cccgaaacat gaggatgatg ttacagcagt tccgggaacg      1260
     caacagcaac ctgctgctaa tgacggctgg gacgatgtcc cgagtgacat tgagcgggca      1320
     gatgaggccg cttcccttca taccatgtca gagcctgagc ttgataccga ggccgagttt      1380
     gagccggact cggatgatga tcccgaattt ggagaacagc caaagcctgt tgcaagaccg      1440
     aagactttct cggagagaat aaaggaagct gtttcatcct ctgctgcgaa acaacaggaa      1500
     caagaaccta tgggcaaacc tccgaagaag ccttccgaga ctgccgaagc aaagaaacct      1560
     cgtgcccgga aggtcaatcc ccaagctcat gcgaactatc gctcattaag catcaacaga      1620
     ggaggttcct cacggggtag agggcgtttc cgccgaaagt aa                         1662
//

If you have problems or comments...

PBIL Back to PBIL home page