(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE420

PENCW_16.PE420       Location/Qualifiers
FT   CDS_pept        956092..957474
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000076720" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18978097"
FT                   /orf_name="Pc20g04200"
FT                   /product="Pc20g04200 protein"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAP85749.1"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR021858"
FT                   /db_xref="UniParc:UPI00018314A6"
FT                   /db_xref="UniProtKB/TrEMBL:B6HDA4"
FT                   /transl_table=1
FT                   /translation="MPPKRERTVQGSCWPCKQRRVKCDLGKPLCQRCISSGAKCCYDKL
FT                   LIRWKKTPSKTQSLTMSESPIMSLNIHLKDNNLAAGDLKALEYFQFALWPLFTTSAHPC
FT                   PPPIPLAMECQPVLLAVCELAEAHRTLRDEAGSSTVSAPFDKRMSCLASVREQLRNNPN
FT                   HTSLSPLLVAVFLLYFLDGFIECDRQSASTASHHVGVQAIVDHLGGFSALIKIGQKDIT
FT                   MLLSEFASTDLTKALLDDRPPCFPAEIWTQIEHGTVWWDQETYNGTTLASVFRIMSEMS
FT                   LYRQKIRGDPETLSMEVVRGFERCLQPSYQILDFDHLENPSTYTAHESTLERRMQADSF
FT                   TRAFQHSALVYLYRAICGLPPRHSLVQQHVQSCVECIRNISPLSKAHNCIIFPLYIMGA
FT                   HTFLQDQQAFVLERLDSIYKYLRFNCVLLVRAALVDLWESPRHDGDWWGMFTSLDEHVL
FT                   VI"
     atgcccccca agcgtgaacg tacggttcaa ggctcgtgct ggccctgcaa acaacgccgg        60
     gtgaaatgcg atcttgggaa gccattatgc cagagatgta tttcatctgg ggcaaaatgc       120
     tgttatgaca agcttttgat caggtggaaa aagacaccat caaaaacaca gagcttgacc       180
     atgtctgagt ccccaattat gagcctcaat atacacttaa aagataataa cttggcggct       240
     ggagatctca aggcccttga gtactttcag ttcgccttat ggcctctttt caccacttcg       300
     gctcatcctt gcccaccacc catacctcta gccatggaat gccaaccggt acttctggcc       360
     gtgtgtgaat tggctgaggc gcatcgcaca ctgcgggacg aggctggaag tagcacggtg       420
     agcgcaccgt ttgataaaag aatgagctgt ctggcttcag tcagggagca gcttcgaaat       480
     aatcccaatc atacatcact ttcgcctctg ctggtcgcag tctttctgct ctatttttta       540
     gacggcttta ttgaatgtga tcgtcaatct gcatcaacgg caagtcacca cgtgggcgtc       600
     caagcgattg tcgatcatct cggaggcttc tcagctctta taaaaatcgg ccaaaaggac       660
     atcactatgc tactatcgga attcgcgtcc acagacctga cgaaggctct gctggacgat       720
     cgacctcctt gctttcccgc tgaaatctgg acacagatag agcacgggac agtgtggtgg       780
     gaccaagaaa catacaacgg cacaacgctg gcatcggtat ttagaatcat gtcggaaatg       840
     tctttgtacc gccagaaaat caggggagac ccagagacac tttcgatgga agtggtgcga       900
     ggatttgagc ggtgtctaca gccgtcatac cagatcctcg actttgacca tctcgaaaac       960
     cccagtacct acactgcgca tgaatcgacg cttgaacgaa ggatgcaggc cgactccttc      1020
     acacgtgctt ttcaacatag tgccctcgtc tacctctacc gagcaatttg tggccttcca      1080
     ccgagacact ctttggtaca acagcatgtc cagtcatgcg tagaatgcat cagaaatatc      1140
     tctcctcttt ctaaggccca taactgtata atatttccat tgtacatcat gggcgcccac      1200
     acattcttgc aagatcagca ggcctttgtc ttggagagac ttgactctat atacaaatat      1260
     ttgcgcttta actgtgtatt gttggttcgt gcagcgttgg tggacttatg ggagtcgcca      1320
     cgtcatgatg gggattggtg gggaatgttt acatctctgg atgaacatgt gcttgtgatc      1380
     tag                                                                    1383
//

If you have problems or comments...

PBIL Back to PBIL home page