(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE424

PENCW_16.PE424       Location/Qualifiers
FT   CDS_pept        963405..963842
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15949942"
FT                   /orf_name="Pc20g04240"
FT                   /product="Pc20g04240 protein"
FT                   /protein_id="CAP85753.1"
FT                   /db_xref="UniParc:UPI00018314A9"
FT                   /db_xref="UniProtKB/TrEMBL:B6HDH2"
FT                   /transl_table=1
FT                   /translation="MTSDSRPCLEAWTCGGEIEDALSHRSSMSEHNWTLALFQKKDSKP
FT                   GSIVRAMRYMPLATPPRPNTTTAIICTSLFHMRWSSRLLFVLQDKLRHGSQVSRMRTRR
FT                   TRSEGCSLLCLILRFHVSCIRVCLDILEHTDTPRERLLPSK"
     atgacttcgg actcccgccc ctgcctggag gcttggacgt gcgggggtga gattgaagat        60
     gcgctatcgc atcggtcgag tatgtcagag cataattgga ctttagctct attccaaaag       120
     aaggactcca aaccgggctc tatagtccgg gcgatgcgat acatgcctct tgcaacaccg       180
     ccgcgaccaa ataccactac agcaattata tgtacatcgc tgtttcacat gcgctggagc       240
     agcagattgc tgtttgtatt gcaagacaaa ctcagacatg ggagtcaagt ctcaagaatg       300
     aggacacgga ggactcgaag cgaaggttgt tcccttcttt gtctgatcct ccgattccat       360
     gtgtcttgca tacgcgtatg tctggatata ctggaacata cagacacccc acgggagcga       420
     cttttaccat ccaaataa                                                     438
//

If you have problems or comments...

PBIL Back to PBIL home page