(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE425

PENCW_16.PE425       Location/Qualifiers
FT   CDS_pept        join(complement(964884..965174),complement(964239..964832))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000196131" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20672205"
FT                   /orf_name="Pc20g04250"
FT                   /product="Pc20g04250 protein"
FT                   /protein_id="CAP85754.1"
FT                   /db_xref="InterPro:IPR009737"
FT                   /db_xref="InterPro:IPR012335"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="UniParc:UPI0001831585"
FT                   /db_xref="UniProtKB/TrEMBL:B6HDH3"
FT                   /transl_table=1
FT                   /translation="MLRSLLSFGRTGTNDYLFPKVDPKEDGPECLKDCADCTVKFPSKV
FT                   KVETSRPLYGQIKEFHSHVLVATGKSDWKEKHVEKMTGSLMEAFDEAESDHGVIKVSAS
FT                   NLTPPEQPTTDEGSNQATTVLILPSFTYVDSVTQADVPNLVAKFIDHPTNQQNGNETTS
FT                   PASGMSARPCELDYVILLCSHGRRDARCGITAPLIKRELERHLRPLGLNRDADDSRAGG
FT                   VGIFFVSHVGGHKFSANVLIYRKKDQQMIWLARVRPEHCEGIVKYTVLQGKVVHPESQL
FT                   RGGFDRLKELTSW"
     atgctgcgtt ccttgctttc cttcggccgc acagggacca acgactacct cttccccaaa        60
     gtggatccca aagaggatgg ccccgaatgc ttaaaggact gcgccgactg cacagtcaag       120
     tttccgtcaa aagtcaaagt agaaacgtca agaccgcttt atggccagat caaagaattc       180
     cattcccacg tcctcgtggc aacgggcaaa tccgactgga aggaaaaaca tgtcgaaaag       240
     atgacaggaa gtctgatgga agcattcgat gaggcagaat cagatcatgg cgtcatcaaa       300
     gtctcagcat caaatctcac tcctccagaa caaccaacca ccgacgaagg ttccaaccaa       360
     gctaccacgg tattaattct gccatcattc acatacgtcg actcggtgac acaagcagac       420
     gttccaaacc tggtagccaa attcatcgac caccccacca accagcaaaa tggaaacgag       480
     accacctctc ccgcgagcgg gatgagcgct cggccttgcg aacttgacta cgtgatacta       540
     ctgtgctcac acggacgccg agacgcgcgc tgtggtatta cagcgccact gattaagcgc       600
     gagctggagc gacatcttcg tcccctgggc ctgaaccggg atgcggatga ctcccgggct       660
     ggcggggtgg gtatattctt tgtgtcgcat gtcggcgggc acaagttctc tgcgaatgtt       720
     ttgatttatc gcaagaagga tcagcagatg atttggcttg cccgtgtccg gcccgagcat       780
     tgtgagggca ttgttaagta cactgttctg cagggaaagg ttgtgcatcc tgagtcacag       840
     ttgaggggtg ggtttgatcg gctgaaagaa ttgacgagtt ggtaa                       885
//

If you have problems or comments...

PBIL Back to PBIL home page