(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE426

PENCW_16.PE426       Location/Qualifiers
FT   CDS_pept        join(966267..966335,966418..966734,966846..967146,
FT                   967218..968496,968555..968967,969026..969100)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000196142" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15949943"
FT                   /orf_name="Pc20g04260"
FT                   /product="Pc20g04260 protein"
FT                   /function="DNA binding"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAP85755.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR007219"
FT                   /db_xref="UniParc:UPI0001831586"
FT                   /db_xref="UniProtKB/TrEMBL:B6HDH4"
FT                   /transl_table=1
FT                   /translation="MKEKKERKDFGQTFHFGSHERDHLVSNECMDVQGNAQPERVRKRR
FT                   RRTMACTQCRTRKLRCDREYPTCSRCLKSRTPSKCTYEDGFLWQQPTTVPTTAFAADRG
FT                   SALSMPRDTPIETPPDSGIPPVSTRRPHDKERKDCFLETVLGAPKAAVNQEPYVNVGVL
FT                   QRPKRPAPAERETQAPSQTDDEHIDEEEDPLSPTDHLDLAPRIMMRGRETQTRFSGSGI
FT                   FANLVAQFPDIKYFAEEIKLSTPIFAQLQPDLRRVKRGLLKHMVLSRPFPDPTTASLIS
FT                   MLPSRGVVDELVGLYITHIESTHRILHVPSFLRELDQFWAMRDSPASISAGFTVQVLLV
FT                   LACAWNLADFASLQSKSSGELKCQSAVEWTLHAGKWIENLHTKRPEITSMRLSILLILA
FT                   RNAHGMRRSQAWLTTSTLVKQAMMAGYHRDPSRYARISVFNKEMRRRLWTTIVELDLQV
FT                   ALDRGMPPSVQSFDYDAAPGMNIYDDEIHENSTEVPESRPLSEVTDSSFQSILSRSLPL
FT                   RLQACSLMHSPRISCRYEDIQRLDSELNRHLSRIPAWVAPDPNDIVAQRKVMLWKGLIE
FT                   TKLCQSLLSVHTPFAIQARRESLFAPSTRTRLDAATRILSTQRRLHEISRTLSLCMLGE
FT                   WTIQAYISICQVLHTTEFDTSPPSYPTSSTFILHNIPGIPESLISLVETALIALEERSL
FT                   LMTKGAKDYYFLSTIVALVKSRLWPAQAAMYKQQVVERVLSFAQILFSRHMHCDHLGDK
FT                   GMGNFKNNQVAAFMAAPTMAPVMQPEFDPNGMHPPQPGAIPPGEFDPFLEIFDWEDLTS
FT                   MTFPC"
     atgaaggaaa aaaaggaaag gaaagacttc ggtcagactt tccactttgg gtcccacgag        60
     cgggaccacc ttgtctccaa cgagtgcatg gatgttcaag ggaatgccca acccgagcgc       120
     gtgcgcaagc gtcgccgccg cacaatggcg tgcacgcagt gtcgcacgcg caagttgcga       180
     tgtgatcgcg aatatcccac ttgcagtcgc tgcttaaaga gcagaactcc gagcaaatgc       240
     acatatgagg atggcttttt atggcagcag cccactactg ttccgaccac ggcatttgct       300
     gccgaccgag ggtctgcatt atctatgcct agagataccc caatcgagac acctccggac       360
     tcggggatac ctccagtgtc aactcgtcga ccacacgaca aagagcgaaa ggactgcttc       420
     ttggaaactg ttctcggtgc tcctaaggct gctgtcaatc aggaacccta cgtaaacgtg       480
     ggtgttttac agcgtcccaa gcgtccggcg ccggctgagc gagaaacaca agctccgtcg       540
     cagaccgacg atgagcacat tgatgaagaa gaggacccgt tgtcacctac ggaccacctc       600
     gaccttgctc ctcgcataat gatgaggggc cgtgaaactc aaacgcggtt cagtggatcg       660
     ggcatctttg ccaatttagt agcacagttt cctgatataa aatattttgc agaagagatc       720
     aaactttcta ccccgatctt cgcgcaactt cagccggacc tgagaagggt taagcgcggg       780
     ctattgaagc atatggtgct cagcaggccc ttccccgacc ctacgacggc ttcgctaatt       840
     agcatgcttc cctcgcgcgg tgtggtcgat gagcttgttg ggttgtatat cactcatatt       900
     gagtccactc accgcattct tcatgttcca tccttcttac gagagcttga ccaattctgg       960
     gccatgcgag atagcccggc ctcaatatct gctggcttta cagttcaggt actgttggtc      1020
     cttgcctgcg cgtggaacct cgcagatttt gctagtctgc agtcaaaaag ttcgggcgaa      1080
     ctcaagtgcc agtctgcagt ggagtggacg cttcatgcag ggaaatggat tgagaatctt      1140
     cacactaagc gtccggagat cacatcaatg cgactctcta ttctgttgat tttagcgcgc      1200
     aatgctcacg gaatgagacg tagccaggct tggctcacaa caagtacatt ggtcaagcaa      1260
     gcaatgatgg cagggtacca tcgcgaccca agccgatacg cacggatctc tgtattcaac      1320
     aaagagatgc gacggcgact gtggacaacc attgtggaac tggacctaca agttgctctt      1380
     gaccggggaa tgccaccgtc agtacaaagc ttcgactatg atgcagctcc ggggatgaac      1440
     atctacgatg acgagatcca cgagaacagc accgaagttc ccgaaagccg gccactgagc      1500
     gaagttaccg actcatcgtt ccagtctata ctgagtcgct cgttacctct ccgccttcaa      1560
     gcatgttctc tcatgcattc cccacggatc agctgtcgat acgaggatat tcagcgcttg      1620
     gacagtgagc tcaaccggca tctttctcgg attcctgcat gggtggcacc agaccccaac      1680
     gacatcgtcg cccaacgcaa agtaatgttg tggaagggat tgatcgagac taagctttgc      1740
     cagtctttac tgtctgtcca cactcctttt gccattcaag cacgacgaga atcactcttt      1800
     gctccctcca cgcgtactcg cctggatgcc gcaaccagga tactgtcaac gcagcgccgg      1860
     ttacacgaga tctcgcggac gctctcgtta tgtatgcttg gcgaatggac tatccaagcc      1920
     tacatttcca tttgccaagt gctacacaca accgaattcg acacctctcc cccctcctat      1980
     cccacctcct cgaccttcat cctccataat atacccggta tccccgaatc gctcatatcg      2040
     ctcgtagaaa cagccctgat cgcattggaa gagcgctccc ttttgatgac caagggagca      2100
     aaggactatt atttcctctc gacgatcgtc gcactagtca aatcacgact ctggccggca      2160
     caggccgcta tgtacaagca acaagttgtc gagcgggtcc tgtcatttgc gcagattctc      2220
     ttctctcggc acatgcactg cgaccacctc ggcgacaagg ggatgggcaa tttcaagaac      2280
     aaccaggtag ctgcctttat ggcggctcca acaatggcac ctgtgatgca gcccgaattt      2340
     gatcccaatg ggatgcatcc gccgcagcct ggcgccatac cacctggcga gttcgatcct      2400
     ttcttggaga tcttcgattg ggaagatctg acaagcatga cgtttccctg ttga            2454
//

If you have problems or comments...

PBIL Back to PBIL home page