(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE427

PENCW_16.PE427       Location/Qualifiers
FT   CDS_pept        join(970066..971067,971129..971261,971314..971339)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000292006" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15949944"
FT                   /orf_name="Pc20g04270"
FT                   /product="Pc20g04270 protein"
FT                   /function="hydrolase activity, hydrolyzing O-glycosyl
FT                   compounds"
FT                   /biological_process="carbohydrate metabolic process "
FT                   /protein_id="CAP85756.1"
FT                   /db_xref="GO:0004553"
FT                   /db_xref="GO:0005975"
FT                   /db_xref="InterPro:IPR006710"
FT                   /db_xref="InterPro:IPR016840"
FT                   /db_xref="UniParc:UPI0001831587"
FT                   /db_xref="UniProtKB/TrEMBL:B6HDH5"
FT                   /transl_table=1
FT                   /translation="MHHLLLLSIIIAIATPLGAIPSQSGAQSAKQVYQTTKKFPLANPG
FT                   NIPVHDPNIILHNEQYYLFKGGVNIPIFKSANVSGPWEKLGTVLAGDSIIPKTNRTRPW
FT                   APTTIEKDGTFYCYYTVSAKGSRDSAIGVATTTSLDGSPWTDHGVLINTGTGAGSGVWP
FT                   YTITNAIDASVVFDRDSGQAYLNYGSFWHDIWQVPLEDDLLSVRDGEAPDAVQLTFIPR
FT                   AKTKPEEGVWVSFRDGFYYAWFSHGNCCNFKNGFPGRGKEYSIRVGRSRSVRGPFEDKT
FT                   GKSLLEGGGTVVYGSNHGAVYAPGGLGVLPGNNDSMDILYYHYLNTSGGFKHGEAQLGW
FT                   NYLKYEDGWPVPVEGTNATANNAFGYGPPGWGYLAIMSGLWLCIWQ"
     atgcaccacc tcctactcct atcaataatc attgcgatcg caaccccact gggagcgatc        60
     ccatcccaat ccggggccca aagcgcgaaa caagtatacc aaacaacgaa aaagttccca       120
     ctcgcaaacc caggcaacat cccagtccac gatcccaaca taatcctcca caacgagcaa       180
     tactacctct tcaaaggcgg ggtcaacatc ccaatcttca aatcagccaa cgtatccggg       240
     ccatgggaaa agctcggcac agtcctcgcc ggcgacagca taatccccaa aaccaaccgc       300
     acccgaccct gggcaccaac aacaatcgaa aaagacggca cattctactg ctactacacc       360
     gtgagcgcga aagggtcgcg cgacagcgcc attggcgtcg caacaacgac ctccctcgac       420
     ggcagtccct ggaccgacca cggtgtgctc attaacacag gcaccggcgc gggatccggg       480
     gtgtggccgt atacgatcac gaacgccatc gacgcgtctg tggttttcga ccgggattct       540
     ggacaggcgt atctcaacta cggcagcttc tggcatgata tctggcaggt gccgctggag       600
     gatgatttgc tttctgttag ggatggtgag gcgccggatg cggtgcagtt gacttttatc       660
     ccgcgggcga agacgaagcc tgaggagggg gtgtgggtta gttttcggga tgggttttat       720
     tatgcttggt ttagtcatgg gaattgttgt aatttcaaga atgggttccc cgggcgtggg       780
     aaggagtata gtattcgggt tgggaggtcg aggagtgtgc gtgggccgtt tgaggataag       840
     acggggaagt ctttgcttga gggtggtggt acggtggtgt atggttcgaa tcatggagct       900
     gtgtatgcac ctggtggtct gggtgttttg cctgggaata atgattccat ggatattctc       960
     tactatcatt atttgaatac ctcgggtgga tttaagcatg gggaagctca gctcggctgg      1020
     aactatctga aatatgagga tgggtggccg gtgcctgttg aaggcacaaa tgcaacagcc      1080
     aataatgcct tcggttatgg accccctggt tggggttatc tagcaatcat gtccggtcta      1140
     tggctgtgca tatggcaata g                                                1161
//

If you have problems or comments...

PBIL Back to PBIL home page