(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE428

PENCW_16.PE428       Location/Qualifiers
FT   CDS_pept        join(complement(971812..972395),complement(971564..971750))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15949945"
FT                   /orf_name="Pc20g04280"
FT                   /product="Pc20g04280 protein"
FT                   /function="binding"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAP85757.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="InterPro:IPR002198"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="UniParc:UPI0001831588"
FT                   /db_xref="UniProtKB/TrEMBL:B6HDH6"
FT                   /transl_table=1
FT                   /translation="MDSVKGKVYAVTGLGGIGLAVARQLHSQGALLSLADLSEKVLSTA
FT                   RQTIEVEFGSATASTITTTVLDISNVSAVQDWIADTVSHFGRLDGAANMAGTIGKKHGT
FT                   GKFVDQDDAEWDMLMRVNVTGLMYCLRAQLRAIMETAPGGKGSIVNASSIQGIKGFALH
FT                   AAYSTTKHAVSGLTKSVSKEVGPEIRVNAVAPGSIQTPLLDMATEIQGGFTMPPVSIPR
FT                   VGTGEEVAQTVVFLLSDASSYTTGQIVSVDGGWE"
     atggactccg tcaaaggcaa agtatacgcc gtaaccggcc taggcggaat cggcctggcc        60
     gtagcacgcc aactacactc acaaggcgcc ctcctctctc tcgccgacct aagcgaaaag       120
     gtcctatcca cagcgcgcca gaccatcgaa gtcgaattcg gttccgcaac agcctcaaca       180
     atcacaacaa ccgtgctgga catcagcaat gtaagcgccg tacaagactg gatcgccgat       240
     acggtctcgc acttcggtcg actggacggt gcggcgaaca tggccggtac gatcggcaaa       300
     aaacacggca ctggtaaatt cgttgaccag gatgatgccg agtgggatat gctgatgcgt       360
     gtcaatgtta ccgggttgat gtattgtttg cgcgcgcagc tgagagccat tatggagact       420
     gcgccgggtg ggaaggggag tattgtcaat gcgtcgagta ttcaggggat taaggggttt       480
     gcgttgcatg ctgcgtattc gaccaccaag catgctgttt ctgggttgac gaagtcggtt       540
     tcgaaggagg ttgggcctga gattagggtt aatgctgttg cgcctggttc tatccagacg       600
     cctttgcttg acatggcgac ggaaatccag ggcgggttca ctatgccgcc cgttagtatc       660
     ccgcgcgtcg ggacgggtga ggaggtggct cagacggttg ttttcttgct cagtgatgct       720
     tcgtcgtata cgactgggca gattgttagt gtggatggtg ggtgggaata a                771
//

If you have problems or comments...

PBIL Back to PBIL home page