(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE429

PENCW_16.PE429       Location/Qualifiers
FT   CDS_pept        complement(973071..973454)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000076619" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15949946"
FT                   /orf_name="Pc20g04290"
FT                   /product="Putative uncharacterized protein Pc20g04290 "
FT                   /protein_id="CAP85758.1"
FT                   /db_xref="UniParc:UPI0001831589"
FT                   /db_xref="UniProtKB/TrEMBL:B6HDH7"
FT                   /transl_table=1
FT                   /translation="MTSPINTNFTQPAECYNSRDAVPASMPSNIQYYNQVPLYQTKSPN
FT                   RDMKAVLQSCCSNGVWIYEDPDPCTAVCDSRSSAEAKKTMYCLNAQMVVYGTKTEKSSA
FT                   TVRRPMGWVSLMVGGLLLSGMFI"
     atgacatctc ccataaacac caatttcaca cagccggccg agtgctacaa ctcgcgcgac        60
     gctgtgcccg cctccatgcc ctccaacatc caatattata accaggtccc gctgtaccag       120
     accaaaagtc caaacagaga tatgaaggct gttttacagt cttgttgttc gaacggggtg       180
     tggatttatg aggatccgga tccttgtacg gctgtctgtg attcgcgttc ttcggcggag       240
     gctaagaaga cgatgtactg cttgaatgcg cagatggttg tatatgggac taaaacggag       300
     aagagctctg cgacagtgag gcgtccgatg ggttgggtgt ctttgatggt tggaggattg       360
     cttttgtcgg ggatgtttat ttga                                              384
//

If you have problems or comments...

PBIL Back to PBIL home page