(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE43

PENCW_16.PE43        Location/Qualifiers
FT   CDS_pept        join(complement(99409..99541),complement(99147..99297),
FT                   complement(98838..99087))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000048507" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15946688"
FT                   /orf_name="Pc20g00430"
FT                   /product="Pc20g00430 protein"
FT                   /protein_id="CAP85372.1"
FT                   /db_xref="UniParc:UPI00018319E2"
FT                   /db_xref="UniProtKB/TrEMBL:B6HFD9"
FT                   /transl_table=1
FT                   /translation="MRSRVLPPLDCMIPSPVSFCFSSFHLFWDTIHHLPSHQTSTLTPM
FT                   TRSHKSNDREHQAEGMMGTRENIPRYFAKSGPTDADPRKTKKDGGGKGNWGRSGEEMQD
FT                   TDYSFANARRRSNSSTQGLADFNTKFEAFEPEPVFEEEAFDGADMTAGNDNTVTKVESA
FT                   SSNGSQADHVGRKY"
     atgaggtcac gagtcttacc ccccttggat tgcatgatac cttctcctgt ctcgttttgt        60
     ttttcctctt ttcatctctt ctgggacaca attcatcatc ttccatcaca tcaaacatcc       120
     acattgacac caatgactcg ctcgcacaaa tccaatgacc gtgaacacca ggccgagggc       180
     atgatgggta cccgtgaaaa tataccacgc tactttgcga aatccggtcc aactgacgct       240
     gatcctcgca agacaaagaa ggacgggggt ggcaaaggca attggggtcg atccggcgag       300
     gaaatgcagg acactgacta ttcgttcgcc aatgctaggc gtcggtccaa cagtagcacc       360
     cagggcctgg ccgacttcaa caccaagttt gaggcttttg aacccgagcc tgtgttcgag       420
     gaagaggcct ttgatggcgc agacatgact gccggaaatg ataataccgt gaccaaggtc       480
     gagagtgcca gtagcaacgg tagtcaggct gatcatgttg gaagaaagta ttag             534
//

If you have problems or comments...

PBIL Back to PBIL home page