(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE430

PENCW_16.PE430       Location/Qualifiers
FT   CDS_pept        join(complement(975449..975582),complement(974811..975402),
FT                   complement(974389..974760),complement(974000..974329))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000196166" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15949947"
FT                   /orf_name="Pc20g04300"
FT                   /product="Pc20g04300 protein"
FT                   /function="NADP+ or NADPH binding"
FT                   /function="flavin adenine dinucleotide binding "
FT                   /function="flavin-containing monooxygenase activity "
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAP85759.1"
FT                   /db_xref="GO:0004499"
FT                   /db_xref="GO:0050660"
FT                   /db_xref="GO:0050661"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="InterPro:IPR020946"
FT                   /db_xref="UniParc:UPI000183158A"
FT                   /db_xref="UniProtKB/TrEMBL:B6HDH8"
FT                   /transl_table=1
FT                   /translation="MPQIKSIAIIGAGPAGAIAVDALAQEKTFDVIRVFERQEKAGGCW
FT                   VSRDDEPPQELDFDGLSARTADAPLEIPEHLPCRMPVVSQDRFMDSPVYPALETNVNAA
FT                   AMSFSQEEIPVVRSQWSIERHGEDTPFRHHSVIRKYIEDLFNRRGYQDLVQYNTTVERA
FT                   IKDPNSQKWVLTFRRTEVVDGVKSDYWWSEEYDAVVVASGHYAVPFIPAIPGLKEFAAR
FT                   YPGSVQHTKHYRGPEKYRGKKVITVGASVSAADTAVSLVDSAQTPVVAVVRGRYNAYFG
FT                   DLAFQHPKIQRRPPISHITSNDQGERTVHFEDGTSETGVDHVIFGTGFSWTLPFLPQVP
FT                   TRNNRVPDLYQHVFYRHDPSLVFVGAVGAGLTFKVFEWQAVAAARVLAGKANLPSIAEQ
FT                   EKWETDRIAQKSDGPGFTVLNPEFEPYFESLRQLAGEPRGTGRRLPRFEQKWLSDFDEG
FT                   HERRKKMWRRANQTARL"
     atgccgcaga tcaagagcat agccataatc ggggcgggcc cagctggcgc cattgcagtt        60
     gacgcactag cacaagagaa aacgttcgac gtcatccgcg tattcgaaag acaagagaaa       120
     gccggcggat gctgggtatc aagagacgac gagccgccac aggagttaga ctttgacggt       180
     ctatcagcgc gaacagcaga tgcgcctctc gaaatccccg agcatctccc gtgccggatg       240
     cccgtagtct cccaggaccg gttcatggac tcacccgtgt acccggcgct ggagactaac       300
     gtgaacgcgg cagccatgtc gttttctcaa gaggagatcc ctgtagttcg gtcccagtgg       360
     tcgattgagc gtcatgggga agatacgcct ttcagacacc attcggttat caggaagtat       420
     attgaggacc tgtttaaccg gagggggtat caggatctcg ttcagtacaa cactaccgtt       480
     gagcgcgcga tcaaagatcc taatagccag aaatgggtgc ttacattccg ccggacggaa       540
     gttgtcgatg gtgtcaagtc ggactactgg tggtccgagg agtatgatgc agttgtggtg       600
     gcttcaggac attacgcagt gccgtttatc cccgcgattc ccggtctgaa ggagtttgct       660
     gcgcggtatc ccggtagtgt tcaacatacg aagcattacc gggggcctga gaaatatcgg       720
     ggaaagaaag tcatcaccgt cggagcgtct gtttctgccg cggatacggc agtgagcctg       780
     gttgatagcg cccagacacc agttgttgct gtggttcggg gtcggtacaa tgcctatttc       840
     ggagatctcg ctttccagca ccctaagatc cagcgtcgcc cgcccatctc gcacattacg       900
     agtaatgatc aaggcgaacg gacggttcat ttcgaggacg gcacctctga gactggagtt       960
     gaccatgtga tttttggaac tggctttagc tggactttgc ctttcttgcc tcaggttccc      1020
     acgcggaaca atcgagtgcc ggatctctac caacacgtct tttacagaca tgatccatca      1080
     ttggtgtttg tcggcgctgt tggtgctggc ttgaccttca aagtcttcga atggcaagcc      1140
     gtcgctgcgg cgcgtgttct agccggcaaa gcaaacctgc cctcgatcgc cgaacaggaa      1200
     aaatgggaaa ccgaccgtat agcacagaag agcgatggac caggcttcac agtcctcaac      1260
     ccggaattcg agccctactt cgagagccta cggcaacttg cgggggaacc tcgtggcacg      1320
     ggacgacggc tacctcggtt cgagcagaaa tggctgtctg atttcgacga agggcatgag      1380
     cgcaggaaga agatgtggcg acgggccaat caaacggctc ggttgtga                   1428
//

If you have problems or comments...

PBIL Back to PBIL home page