(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE431

PENCW_16.PE431       Location/Qualifiers
FT   CDS_pept        join(complement(979669..979789),complement(979342..979587),
FT                   complement(978819..979259),complement(976211..978762))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000093545" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18129262"
FT                   /orf_name="Pc20g04310"
FT                   /product="Pc20g04310 protein"
FT                   /function="FMN binding"
FT                   /function="electron carrier activity"
FT                   /function="heme binding"
FT                   /function="monooxygenase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAP85760.1"
FT                   /db_xref="GO:0004497"
FT                   /db_xref="GO:0009055"
FT                   /db_xref="GO:0010181"
FT                   /db_xref="GO:0020037"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="InterPro:IPR001128"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR002401"
FT                   /db_xref="InterPro:IPR003097"
FT                   /db_xref="InterPro:IPR008254"
FT                   /db_xref="InterPro:IPR015702"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR017972"
FT                   /db_xref="InterPro:IPR023173"
FT                   /db_xref="InterPro:IPR023206"
FT                   /db_xref="UniParc:UPI000183158B"
FT                   /db_xref="UniProtKB/TrEMBL:B6HDH9"
FT                   /transl_table=1
FT                   /translation="MSSTDQVPIPGPKGVPFLGNVYDIEPELPLQSFERMADSYGPIYR
FT                   LTTFGRARVFVSSHELVDEVCDEERFSKMVSAGLAEIRNGVHDGLFTANYPGEENWAIA
FT                   HRILVPAFGPLMIRGMFDEMYDIATQLVMKWARIGPAAPIQVTDDFTRLTLDTIALCAM
FT                   GTRFNSFYHDEMHPFVEAMVGLLSVSGHRALKPALLNNLPTSENNKYWSDIEYLRNLSK
FT                   ELVDSRKENPVDKKDLLNALILGRDPQTGRGMTDDSIVDNMITFLIAGHETTSGMLSFL
FT                   FYHLLKNPSAYRKAQDEVDRVIGKRKITVDDMSKLPYITAVMRETLRLNPTAPMIALHP
FT                   HPTKNKEDPVTLGGGKYVLNGDETIALLLTKMHRDPKVYGPDADEFKPERMLDENFEKL
FT                   PKNAWKPFGNGMRGCIGRPFAWQEALLVVAILLQNFNFQMENPSYDLRLKQTLTIKPKD
FT                   FHMKATLRDGLDPTQLSTTLSGSGAGPTETGAASRDRKPKVAPAGGKLKPMHVFYGSNT
FT                   GTCEAFARRLADDAAAYGYAAQTNSLDSAMQNIPKNDPVVFISASYEGQPPDNAAHFFQ
FT                   WLSELKGSELEGVNYAVFGCGHHDWSSTFYRVPKAIDELAKTNGANKLCDIGLADAANS
FT                   DMFTDFDGWGETLFWPGVMAKFGGTSPEPAAKPKSSLQVEVSSGMRASTLGLQLEEGFV
FT                   IENQLLTPPGAPAKRVVKFKLPSDMTYQCGDYLAVLPVNPSPVVRRAIRRFDLPWDAVL
FT                   KVKKPSGSTSSPSIPIDTPISAFELLSTYIELSQPASKRDLNVLADAAISDAELQAELR
FT                   YLASSPSRFTEEIVKKRVSPLDLLIRYPSIKLLIGDFLAMLPPMRVRQYSISSSPLVDP
FT                   SECSITFTVLSAPALANATPEGSESIEQYLGVASNYLSELQAGERAHITVRPSHSGFKP
FT                   PMDLETPMIMACAGSGLAPFRGFVMDRAEKIRGRRSSPDSDELHESETFKPAKAVLYIG
FT                   CRTKGQDDIHAAELAEWAALGAVDVRWAYSRPADGSKGQHVQDAMLDDREELVKLFDEG
FT                   ANIYVCGSTGVGAGIRDACKQMYLERRRAVHAELREKGETPPGADLEEDQAAEQFFDNL
FT                   RTKERYATDVFT"
     atgagctcga ccgaccaggt cccaatcccg ggccccaagg gtgtcccatt cttaggaaac        60
     gtctacgaca tcgagcccga gttgcccttg caaagctttg agcggatggc cgatagctat       120
     ggcccaatct atcgcttgac cacctttggc agagcacgag tattcgttag ctcccacgag       180
     ctagtggacg aagtctgtga cgaggaacgc ttcagcaaaa tggtctccgc tggtctggct       240
     gagattcgca atggtgttca cgacggtctt tttaccgcga actatcccgg tgaagagaac       300
     tgggctatcg cgcatcgcat tcttgttcct gcattcggtc cgctgatgat tcgcggcatg       360
     tttgatgaaa tgtatgatat tgccactcaa ctggttatga aatgggctcg gattggccct       420
     gctgccccaa tccaggttac agatgacttc acccgcttga cgctagatac cattgctctt       480
     tgcgctatgg gcacccgctt caactcgttc taccatgatg aaatgcaccc attcgtcgag       540
     gcaatggttg gcttgctatc tgtgtctgga catcgggctc ttaagcctgc tttgctcaac       600
     aacctcccca cttcagagaa caacaagtac tggagtgaca ttgagtatct gcggaatcta       660
     tccaaggaat tagttgattc acggaaagag aaccccgttg acaagaagga tcttctcaat       720
     gcgcttatcc tgggtcggga cccgcagact ggccggggta tgacagatga ctcgattgta       780
     gacaacatga tcacattcct catcgctggg cacgagacca cctccggcat gttgtcattc       840
     ctattctacc atcttctcaa aaaccccagc gcatacagaa aggctcaaga cgaagtcgac       900
     cgtgtgattg gtaaacgcaa gatcaccgtt gatgacatgt ccaagctgcc atacatcacc       960
     gctgtgatgc gcgagacgct gcgtctgaac cccacagccc cgatgattgc cctgcacccc      1020
     caccccacta agaacaagga ggatcctgtt acacttggag gtggcaagta cgtgcttaac      1080
     ggggacgaga caattgcgct cctacttacc aaaatgcacc gagacccgaa ggtctacggc      1140
     cctgacgccg acgagttcaa gccagagcgc atgctcgatg aaaacttcga gaagctgccc      1200
     aagaatgcat ggaagccatt tggaaacggc atgcgaggct gtattggacg gccgttcgca      1260
     tggcaagagg ctctccttgt agttgcgatt ttgctgcaga actttaactt ccagatggag      1320
     aaccccagct acgatctccg ccttaagcag acacttacca tcaagcccaa ggatttccac      1380
     atgaaagcga ctctgaggga tggactcgac cctactcaac taagcactac cctcagcggc      1440
     tctggtgccg ggcccacaga gactggcgcc gccagccggg atcgcaagcc caaggttgca      1500
     cccgcgggtg gcaagctgaa gcccatgcac gtgttctacg gcagcaacac aggaacctgt      1560
     gaggccttcg cccgcaggct ggccgacgat gccgctgcat acggttatgc tgcgcagaca      1620
     aactctttag attcagccat gcaaaatatc cccaagaacg accctgttgt ctttatctca      1680
     gcgtcttacg aaggacagcc tccggacaat gcggcccact tcttccaatg gctcagtgag      1740
     ttgaagggca gcgagttaga aggtgtcaac tacgcagtct tcggctgtgg ccaccatgat      1800
     tggtcgtcaa ccttctaccg tgtccccaag gccatcgacg aactagccaa gaccaatggg      1860
     gccaacaagc tctgcgacat tggtcttgct gacgcagcaa actcagacat gttcaccgat      1920
     ttcgatggct ggggcgagac cttattctgg ccgggcgtga tggctaaatt cggtggaact      1980
     agcccggaac ccgccgccaa gccgaagtct tcattgcagg tcgaagtgag ctcgggtatg      2040
     cgcgcatcca ccctgggtct ccagctcgaa gaaggtttcg tcattgagaa ccagctcctt      2100
     acgccacccg gggccccagc caaacgagta gtcaagttca agctaccgtc agacatgacc      2160
     taccagtgcg gtgattacct cgcagtgcta cccgtgaacc caagcccagt cgtccgtcgc      2220
     gcaatccgcc gcttcgacct cccctgggac gccgtgctca aagtcaagaa accctcaggc      2280
     tcaacatcct ccccctcgat ccccatcgac acgccgatct cagccttcga gctcctatcc      2340
     acctacatcg agctatccca acccgcatcg aagcgcgatc tcaatgtcct agccgacgcc      2400
     gccatctcag acgcggaact gcaagccgaa ctacgctatc tcgcatccag ccccagccgc      2460
     ttcacggaag aaatcgtcaa gaagcgcgtc agcccgctgg atctgctaat ccgctatcca      2520
     tcaatcaagc tactgatcgg cgacttcctc gcaatgctcc caccaatgcg cgtgcgacaa      2580
     tactccatct cctcgtcacc actcgtcgac ccatccgagt gctcgataac cttcaccgtc      2640
     ctcagcgctc cggccctcgc caacgccacc ccagaaggca gcgaaagcat cgaacaatac      2700
     ctcggcgttg catccaacta cctctccgag ctccaagccg gtgaacgcgc acacatcacc      2760
     gtccgtccct cgcactcagg cttcaagccg cccatggatc tcgaaacacc gatgatcatg      2820
     gcctgcgcgg gctctggact cgccccgttc cgtggattcg tgatggaccg cgcggagaag      2880
     atccgcggcc gccgcagctc gcctgactca gacgaactcc atgaaagcga gactttcaag      2940
     cctgcaaagg cggtgttgta tattggctgc cgcacgaagg gccaggatga tatccacgct      3000
     gctgaacttg cggagtgggc tgctctcggc gctgtcgatg tccgctgggc gtatagccgc      3060
     cctgctgatg gaagcaaggg acagcatgtt caggatgcca tgcttgatga ccgcgaagag      3120
     ctggtgaagc tgtttgatga aggagcgaat atttatgttt gcggtagtac tggtgttggt      3180
     gctggtattc gcgacgcttg caaacagatg tatctcgaga ggcgtcgtgc ggtgcacgct      3240
     gagcttaggg agaaggggga gactccgcct ggtgctgatc ttgaggagga tcaggctgct      3300
     gagcagttct ttgataattt gcggacgaag gagcgttatg ctaccgatgt gtttacttag      3360
//

If you have problems or comments...

PBIL Back to PBIL home page