(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE432

PENCW_16.PE432       Location/Qualifiers
FT   CDS_pept        join(complement(981315..982114),complement(980961..981261))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000196187" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15949948"
FT                   /orf_name="Pc20g04320"
FT                   /product="Pc20g04320 protein"
FT                   /function="hydrolase activity, hydrolyzing O-glycosyl
FT                   compounds"
FT                   /biological_process="carbohydrate metabolic process "
FT                   /protein_id="CAP85761.1"
FT                   /db_xref="GO:0004553"
FT                   /db_xref="GO:0005975"
FT                   /db_xref="InterPro:IPR000757"
FT                   /db_xref="InterPro:IPR008985"
FT                   /db_xref="InterPro:IPR013320"
FT                   /db_xref="UniParc:UPI000183158C"
FT                   /db_xref="UniProtKB/TrEMBL:B6HDI0"
FT                   /transl_table=1
FT                   /translation="MFFSRIAILAALAGYATAQTSTECDPTKEDCPPDPALGTEHTWNF
FT                   NTTLDEKIWNMTTGTYEYEDDGAKFTLQREGESTLLQSNFYIFFGVVEAHVKMATGKGL
FT                   VSSVVLESDDLDEIDWEWMGYNTSEVQSNFFGKGNDTTFDRGGHHHVANADTEFHNYTT
FT                   YWDQDKLQWWIDGEMVRELPYNDESALFGKNYPQTPCRVQFSLWPAGRKDAPQGTIDWA
FT                   GGLVDWDTAPFTMTLGKLRVKDFHSGKEYSYGDRSGSWESIEILEGNSTALNELNKPEP
FT                   KSLSEKWDDLGEGAHIGVYIGAGVAGAIAIAGFLFFCLRQRRKGRLENALGNNPVPLNR
FT                   AEMENFQKDWRQSEWKHNGGYQQVSN"
     atgtttttct ctcgcattgc cattctggca gctttggctg gctatgccac cgctcaaacc        60
     tcaaccgagt gtgacccgac caaggaggac tgtcctcccg atcccgcttt gggcactgaa       120
     cacacatgga acttcaacac gactttggac gaaaagatct ggaatatgac caccggaacc       180
     tacgagtacg aagacgatgg agccaagttc accttgcaga gggaggggga gtccactctc       240
     ctacagtcca acttctatat cttcttcggt gtcgtcgaag ctcacgtcaa gatggccacg       300
     ggcaagggtc tagtcagcag tgttgtcttg gagtctgacg atctggatga gatcgactgg       360
     gagtggatgg gatacaacac tagtgaagtg cagtccaact tctttggcaa gggtaatgat       420
     accaccttcg atcgcggcgg ccatcaccac gtggcgaacg cagacaccga gttccacaac       480
     tacaccacat actgggacca ggataaactc caatggtgga ttgacggcga gatggttcgc       540
     gaactcccgt acaacgatga gtccgccttg tttggcaaga actacccaca gaccccgtgt       600
     cgtgtccaat tcagtctctg gcccgctggc cggaaagatg ccccacaggg tactatcgac       660
     tgggctggtg gccttgtcga ctgggatacc gcccctttta ctatgacgct tggcaagctg       720
     cgtgttaaag atttccactc gggcaaggag tacagctacg gagaccgttc aggttcctgg       780
     gagagcatcg agatattaga aggaaactcg actgcactga acgaactgaa caaaccagag       840
     cccaagtctc tgtcagagaa gtgggatgat ctcggcgagg gagcccacat tggagtgtac       900
     attggcgccg gcgtcgccgg tgcaattgct atcgcaggct tcctgttctt ctgcctgcgc       960
     cagcgccgca agggccgtct cgagaacgcg ctcggcaata acccggttcc tcttaaccgt      1020
     gctgagatgg agaacttcca aaaagactgg aggcagagcg agtggaagca taacggtggt      1080
     taccagcagg tcagcaacta g                                                1101
//

If you have problems or comments...

PBIL Back to PBIL home page