(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE433

PENCW_16.PE433       Location/Qualifiers
FT   CDS_pept        join(complement(984377..984379),complement(983874..984236))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000196188" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19824905"
FT                   /orf_name="Pc20g04330"
FT                   /product="Pc20g04330 protein"
FT                   /protein_id="CAP85762.1"
FT                   /db_xref="UniParc:UPI000183158D"
FT                   /db_xref="UniProtKB/TrEMBL:B6HDI1"
FT                   /transl_table=1
FT                   /translation="MAPINSMLEPRQSSGDTCPSTISGGGIAGIVIGSIAGTLLILWLW
FT                   RIFRLPGAWSGGDTSDVGYRPPITRSSTSSRGKRQRRRPSATYVDYVEKPTTVRSSRRY
FT                   RDHDDLRRPAKVYLSEP"
     atggccccta taaattccat gctcgagccc cggcagtcaa gcggcgatac ctgcccaagc        60
     acaatctccg gcggtggaat tgcgggtatc gttatcggct ccatcgctgg gaccctcctc       120
     atcctctggc tgtggcgaat attccgactt cccggtgcat ggagcggtgg cgatacgtct       180
     gacgtcggct accggcctcc aattactcgc agcagcacga gtagccgcgg aaagcgacag       240
     cgccgtcgcc cgtctgcgac gtacgtcgac tatgttgaga aaccgactac tgtgcgcagt       300
     tcacgccggt atagggatca tgatgatttg cgacgaccgg ctaaggttta tctgtcggag       360
     ccatga                                                                  366
//

If you have problems or comments...

PBIL Back to PBIL home page