(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE438

PENCW_16.PE438       Location/Qualifiers
FT   CDS_pept        join(complement(995591..995632),complement(995232..995455),
FT                   complement(995067..995151))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000270245" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15949952"
FT                   /orf_name="Pc20g04380"
FT                   /product="Pc20g04380 protein"
FT                   /function="RNA binding"
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="small ribosomal subunit"
FT                   /protein_id="CAP85767.1"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="GO:0015935"
FT                   /db_xref="InterPro:IPR001848"
FT                   /db_xref="InterPro:IPR005729"
FT                   /db_xref="InterPro:IPR018268"
FT                   /db_xref="UniParc:UPI0001831592"
FT                   /db_xref="UniProtKB/TrEMBL:B6HDR5"
FT                   /transl_table=1
FT                   /translation="MSFQKPEKDFGEGPKVHKIRITLTSRKVASLEKVCQELIDRARSK
FT                   SLQVKGPVRLPTKTLQISTRKTPNGEGSKTWDKYEMRIHKRLIDLLAPTETVKQIIINI
FT                   EAGVEVEVTIAA"
     atgtctttcc agaagcccga gaaggatttc ggcgagggcc ctaaggtcca caagatccgc        60
     atcaccctca cctcccgcaa ggttgcctcc ctcgagaagg tctgccagga gctgatcgac       120
     cgtgcccgct ccaagtccct ccaggtcaag ggccccgtcc gtcttcccac caagaccctc       180
     cagatctcca cccgtaagac ccccaacggt gagggttcca agacctggga caagtacgag       240
     atgcgcatcc acaagcgtct catcgacctc ctcgccccca ccgagaccgt caagcagatc       300
     atcatcaaca tcgaggctgg tgttgaggtt gaggtcacca ttgccgctta a                351
//

If you have problems or comments...

PBIL Back to PBIL home page