(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE439

PENCW_16.PE439       Location/Qualifiers
FT   CDS_pept        996038..998125
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000184807" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20672206"
FT                   /orf_name="Pc20g04390"
FT                   /product="Pc20g04390 protein"
FT                   /protein_id="CAP85768.1"
FT                   /db_xref="InterPro:IPR003892"
FT                   /db_xref="InterPro:IPR009060"
FT                   /db_xref="UniParc:UPI000183167C"
FT                   /db_xref="UniProtKB/TrEMBL:B6HDR6"
FT                   /transl_table=1
FT                   /translation="MAEFPPLAPVPSPAVRRTIPSNDWEACLDAWMALLGIRLNASDQQ
FT                   FKVAASEDASIPLFLGSYYQYTAAGDSSLQSGPKARQLRKLCFLAIRRYILDLTNPPDG
FT                   IMDWRLLGNLCCCHPASAALKTSLSSAWDMHQSKITSSLERAKATVIKNLSSANSSSNP
FT                   EVISDIRRLTILASVLPACGQELMAGSDFLDTISEAYQSKGARDEFRRILVANVYVGLI
FT                   SLLKEPVNLSSLLDQLFSLKAAARVGAPKMKKEPTLLSDLICSSDVLVRLEKYLSIHPQ
FT                   KRGQDLLASLRTYQVESKPLHHRYQRRKKVDKGKGVSSDPIVSGELHAHKMSLVTQVQD
FT                   LFPDLGSGFVVRLLDFYNDNPETIVTHLLDDSLPLELQSLDRSEQLPPPAEPHHSHLPP
FT                   QPTPPAMPSPTFAPLPTRKNIFDKDVDIAELSRSSEAQGKLHFGRADADQTADTLLAGH
FT                   GKHAANKAAILSALATFDSDDDERDDTYDAADVGGAIDGAAGGTDGEADAAQRDRRAAD
FT                   IETVLFRAYKSNPGLFARDSATRRSQPRASLKRETEMTDEAIEGWALMLTRDPKRIAKL
FT                   EDRLAMDAGGSAGAGPLNQPELRPTSYRRPQPREDGDEGSDEGDSSGHAGPRGGRGGGG
FT                   RGRGRGGGRGRGGRGGSGGQGQPDTAASRQRKEENKGSRANHNRRQQHAKKMARGGGLP
FT                   G"
     atggcggagt tcccgccgct ggctccagtg ccttcccccg cagtgcggag gacaatccca        60
     tcaaatgact gggaagcttg tctagatgca tggatggccc tgttagggat ccgcctgaat       120
     gcatcagatc agcaatttaa ggttgcagca tctgaagatg catcaatacc cctattcctt       180
     ggatcctact atcaatacac ggctgctggt gattccagtc tacaaagtgg acctaaagct       240
     cgacaacttc ggaagctctg ctttctggcg ataagaagat acatactcga tctcacaaat       300
     ccaccagacg gaattatgga ctggagactt cttggcaatt tatgttgctg tcaccctgct       360
     agcgcggcct tgaagacgtc attatcaagt gcctgggata tgcaccagag caaaatcact       420
     tccagtctcg agagagcaaa agctactgtg atcaagaacc tctcttcggc caactcatcc       480
     tcaaatcccg aagtcatttc tgacatccgt cgtctgacca tccttgcctc agtgctgccg       540
     gcatgtggcc aggagctcat ggcgggctcc gacttcctgg acacaatatc agaagcctac       600
     cagtcaaaag gtgcccggga tgagtttcgc aggattctcg tcgctaacgt ctacgtcggg       660
     ctgatctcct tattgaagga gcccgtcaat ttatcttcgt tattagatca gctgttcagc       720
     ctcaaagccg ctgctcgagt gggggcaccg aaaatgaaga aggaaccgac tttactctct       780
     gatctcatct gcagctcaga cgtgcttgtt cggctggaga agtatctgag cattcacccc       840
     cagaaacggg ggcaagacct gcttgccagc ttgcgcacct atcaagtgga atcgaaaccc       900
     ctacaccatc ggtatcaaag acgcaaaaag gtggacaagg ggaaaggagt gtcctcagat       960
     ccgatcgttt caggagaact tcatgcacac aagatgtcac ttgtcactca agtacaagac      1020
     ctcttccccg atcttggctc aggatttgtt gtacggttac tggacttcta caacgacaac      1080
     cccgagacta tcgtcaccca tcttctcgac gactcacttc ctctagagct ccagtctctt      1140
     gatcgatccg agcaactgcc tcccccagca gaaccccacc atagccatct cccgccacag      1200
     ccaacaccac ccgccatgcc atcaccaacc ttcgcgccac tgccaacccg caagaacatc      1260
     ttcgacaaag acgtggatat tgcggaacta agccgctcca gcgaagcaca agggaaacta      1320
     cactttggcc gcgccgacgc agaccaaaca gccgacacac tgctcgcagg ccacggcaag      1380
     cacgccgcaa acaaagcagc aatcctctcc gccctagcaa cgttcgactc agacgacgat      1440
     gaacgcgacg acacctacga cgcagccgac gtaggcggcg ccatcgacgg agccgcaggt      1500
     ggcacagatg gcgaagccga cgcagctcag cgcgaccgcc gggcagcaga tatcgaaaca      1560
     gtccttttcc gagcatacaa gtccaatcca gggcttttcg cccgcgactc agcgacccgc      1620
     cgctcacagc cgcgcgcgtc gttgaagcgc gagaccgaaa tgaccgacga ggctatcgag      1680
     ggctgggctc tcatgctaac gcgtgatccc aagcgcatcg ctaaactcga agatcggctg      1740
     gctatggacg ccggcgggtc ggctggtgct gggccactca accagcctga gttgcgtcct      1800
     acttcttata gaagaccgca gcctcgtgag gatggagacg agggttctga tgagggcgat      1860
     tcctctggtc atgctggtcc gcgaggtggt agaggaggcg gtgggcgtgg acggggacga      1920
     ggtggcggtc gtggccgtgg gggccgtggt ggttctggcg gccaggggca gccggataca      1980
     gcggcgtcga gacagagaaa ggaagagaac aaaggtagtc gggcaaatca taaccgtcga      2040
     cagcaacacg cgaagaagat ggcgcgtggc ggtggattgc ctggctaa                   2088
//

If you have problems or comments...

PBIL Back to PBIL home page