(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE44

PENCW_16.PE44        Location/Qualifiers
FT   CDS_pept        join(complement(102012..102025),complement(101819..101903),
FT                   complement(101741..101766),complement(101176..101677),
FT                   complement(100966..101109))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000105220" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19824087"
FT                   /gene_name="rps1"
FT                   /orf_name="Pc20g00440"
FT                   /product="40S ribosomal protein S1 "
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="ribosome"
FT                   /protein_id="CAP85373.1"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="InterPro:IPR001593"
FT                   /db_xref="InterPro:IPR018281"
FT                   /db_xref="UniParc:UPI00018319E3"
FT                   /db_xref="UniProtKB/Swiss-Prot:B6HFE0"
FT                   /transl_table=1
FT                   /translation="MAVGKNKRLSKGKKGIKKRTVDPFTRKDEYSVKAPSTFQTRDVGK
FT                   TLVNRTSGLKNANDSLKGRIFEVSLADLQNDEDHAFRKVKLRVDEIQGKNCLTNFHGLD
FT                   FTTDKLRSLVRKWQSLIEANITVKTTDDYLLRLFAIAFTKRRPNQIKKTTYARSSQIRA
FT                   IRKKMTEIIQREASTCTLSQLTHKLIPEVIGREIEKSTQGIYPLQNVHIRKVKLLKSPK
FT                   FDLGALLALHGESATDDKGQKVEREFKETVLESV"
     atggctgttg gaaagaacaa gcgcctatct aagggtaaga agggtatcaa gaagcgcaca        60
     gtcgacccct tcactcgcaa ggacgagtac tctgtgaagg ctccctccac cttccagacc       120
     cgcgatgtcg gcaagactct ggtcaaccgc accagcggtc tgaagaacgc caacgactcc       180
     ctcaagggcc gtatcttcga ggtctccctc gccgacctcc agaacgatga ggaccacgcc       240
     ttccgcaagg tcaagctccg cgtcgacgag atccagggca agaactgcct gaccaacttc       300
     cacggtctcg acttcaccac cgacaagctc cgttcccttg tccgcaagtg gcagtccctg       360
     attgaggcca acatcaccgt gaagaccact gatgactacc tcctccgcct gttcgccatt       420
     gccttcacca agagacgccc caaccagatc aagaagacca cctacgcccg ctcgtctcag       480
     atccgtgcca tccgcaagaa gatgaccgag atcatccagc gcgaggcttc cacctgcacc       540
     ctgtctcagc tcacccacaa gctcatcccc gaggttattg gacgtgagat cgagaagtcc       600
     acccagggca tctaccccct gcagaatgtc cacattcgca aggttaagct cctcaagtcg       660
     cccaagttcg acctcggtgc tctcctcgct ctgcacggag agtccgcgac tgatgacaag       720
     ggacagaagg ttgagcggga gttcaaggag accgtcctcg agagtgttta a                771
//

If you have problems or comments...

PBIL Back to PBIL home page