(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE440

PENCW_16.PE440       Location/Qualifiers
FT   CDS_pept        join(complement(999922..1000124),c
FT                   omplement(998393..999857))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000184828" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20672207"
FT                   /orf_name="Pc20g04400"
FT                   /product="Pc20g04400 protein"
FT                   /EC_number="1.14.19.3"
FT                   /function="heme binding"
FT                   /function="linoleoyl-CoA desaturase activity"
FT                   /biological_process="fatty acid biosynthetic process "
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAP85769.1"
FT                   /db_xref="GO:0006633"
FT                   /db_xref="GO:0016213"
FT                   /db_xref="GO:0020037"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="InterPro:IPR001199"
FT                   /db_xref="InterPro:IPR005804"
FT                   /db_xref="InterPro:IPR012171"
FT                   /db_xref="InterPro:IPR018506"
FT                   /db_xref="UniParc:UPI000183167D"
FT                   /db_xref="UniProtKB/TrEMBL:B6HDR7"
FT                   /transl_table=1
FT                   /translation="MEKTASRPSRKDTLLTRRYIEGLIAEGKHVIIFEGRVLRVDPFIR
FT                   YHPGGEKPIKHMVGRDATDEINALHSEEARQRMHSYQIGRIEGTWINFLPPIQGGKFRA
FT                   YTEDTCSSDEDSTTPEIFSGSSQDGSIPPSPVFDAVDSKSTVRQRKPTGTTSTEQSQAK
FT                   PAFLDARTREEIVLDTAKYPSLDPASQEEIKRKYRELNERIKAEGLYDCNYSCYFVECC
FT                   RYTLFAGLSYTFLRMGWWATSAFFLGCFWHQLVFTAHDAGHMGITHNFHVDTVIGMFIA
FT                   DYLGGLSLGWWKRSHNVHHIVTNEPEHDPDIEHIPFFAISHRFLTSLRSTYYDRIMTFD
FT                   APARFLLKFQNYSYYPIMMLARFNLYVLSWEYLLKGQAPKRGPAWWHVWFELVGQVFFW
FT                   TWFGYGVMYKTLPDASSRIIFLLVSHIVSSPLHVQITLSHFAMSTADLGVGESFAQKML
FT                   RTTMDVDCPTWLDFFHGGLQFQAIHHLYPRIPRHNLRRTQKFVIEFCRDTGIPYAIFTF
FT                   YDGNKEVISRLGDVAKQVRLMEECRKSIAEDGVFSHHH"
     atggagaaga ccgcatcccg accgtcccgg aaggacaccc tcttgactcg acgatatatt        60
     gaaggcctca tagcagaagg aaagcatgtc ataatcttcg agggccgtgt cctaagggta       120
     gacccattca tcagatatca tcccggaggg gagaagccaa tcaagcatat ggtgggcagg       180
     gatgcgacag atgagatcaa cgcgctgcac tccgaagaag cccgccagcg tatgcactcg       240
     taccagattg gacgaattga aggaacatgg atcaatttcc taccaccgat ccagggcggc       300
     aagttccgcg cctataccga agacacgtgc tccagcgatg aggattcaac aaccccagag       360
     atcttcagtg gctccagtca agatggatca attcctccct cgccggtatt cgatgcggtc       420
     gactcgaaat ccacagttcg tcaacgcaaa ccgaccggaa ccacttcgac cgaacaatcc       480
     caggccaagc ctgccttcct ggatgcaagg acacgagagg aaatcgtctt ggatactgcc       540
     aaatatcctt ccttggatcc cgcgagtcag gaggagatca aacgaaaata ccgcgaactg       600
     aacgagcgta tcaaggccga gggactctac gactgcaact actcttgtta tttcgttgaa       660
     tgctgtcggt acacactttt tgccggtctt tcctacacgt tcctccgtat gggatggtgg       720
     gcaacctcgg cattcttcct cggttgtttc tggcatcagc ttgttttcac cgcccatgat       780
     gctggtcata tgggcattac acacaatttc catgtggata ctgtcattgg aatgttcatc       840
     gcagactacc tcggaggact gagtctcggg tggtggaaac gaagccacaa tgttcaccat       900
     atcgtgacca atgagccaga gcatgacccg gatattgagc atatcccatt cttcgctatc       960
     tcgcatcgct tcctgacgag tctgcggagc acgtattatg atcgaatcat gaccttcgac      1020
     gccccagccc gatttttact caaattccag aattactcct attaccctat tatgatgctc      1080
     gctcgattca atctttatgt tttgagttgg gagtatctac taaagggaca agctcctaaa      1140
     agggggcccg cttggtggca tgtttggttt gagcttgtcg gacaggtctt cttttggacc      1200
     tggtttggct acggtgttat gtataagacg cttcccgatg caagcagccg catcatcttc      1260
     cttctcgtct cgcacatcgt ctcctccccg ctacacgtcc aaatcacctt atcccacttc      1320
     gctatgtcca ccgccgacct gggtgttggt gagtccttcg cgcagaagat gctccgtacc      1380
     actatggacg tcgactgtcc aacatggctg gatttcttcc atggcggctt gcaattccag      1440
     gccattcacc atctctaccc gcgcatcccg cgccataacc tgcgtcgtac gcagaaattc      1500
     gtcatcgaat tctgccgcga tactggtatc ccttatgcca tcttcacttt ctatgatggc      1560
     aacaaggagg ttatcagccg acttggtgat gtcgcaaaac aggtccgcct catggaagag      1620
     tgccgcaagt ccattgccga ggacggagtc ttctcacacc accactga                   1668
//

If you have problems or comments...

PBIL Back to PBIL home page