(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE441

PENCW_16.PE441       Location/Qualifiers
FT   CDS_pept        join(1000393..1000398,1000452..1000496,1000551..1000629,
FT                   1000683..1001002,1001054..1001072,1001123..1001132,
FT                   1001184..1001364,1001414..1001703,1001759..1002435,
FT                   1002488..1002648)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000268676" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15949953"
FT                   /orf_name="Pc20g04410"
FT                   /product="Pc20g04410 protein"
FT                   /function="intramolecular transferase activity,
FT                   phosphotransferases"
FT                   /function="magnesium ion binding"
FT                   /biological_process="carbohydrate metabolic process "
FT                   /protein_id="CAP85770.1"
FT                   /db_xref="GO:0000287"
FT                   /db_xref="GO:0005975"
FT                   /db_xref="GO:0016868"
FT                   /db_xref="InterPro:IPR005841"
FT                   /db_xref="InterPro:IPR005843"
FT                   /db_xref="InterPro:IPR005844"
FT                   /db_xref="InterPro:IPR005845"
FT                   /db_xref="InterPro:IPR005846"
FT                   /db_xref="InterPro:IPR016055"
FT                   /db_xref="InterPro:IPR016066"
FT                   /db_xref="UniParc:UPI000183167E"
FT                   /db_xref="UniProtKB/TrEMBL:B6HDR8"
FT                   /transl_table=1
FT                   /translation="MAQSITSLTEQWLQWDQDPTTRVEIEQLRDSKATEELEKRLRNRI
FT                   EFGTAGLRGRMAAGFSCMNSLIVIQASQGLAKFIRDKRSEIASNGVVIGHDARHNSAKL
FT                   AALAANAFIAQRIPVWFFNEEGPTPMVAFGVNYFGAAAGIMVTASHNPPQDNGYKVYSN
FT                   NGAQINRPEDGEIAQSIQENLEPWPTAWAELQPGEFLRADSYQKLLPHYSSQVAKYTKS
FT                   TVTDWQPPRPFVYTPLHGVGGLVLPNLCRSLGINEFSSVAAQEKPDPDFPTVKFPNPEE
FT                   AGALDLAIETADQEGKTLIVANDPDADRFAVAEKVDGKWHTLTGNHLGVLLASHVLDSF
FT                   DASKNWSHIAVLTTTVSSGMLGKMAAAKGIHFVETLTGFKWMANVARDLEKEGKTVPFA
FT                   YEEALGYMFPSVCYDKDGITAAAVFLAAEAKWRAQGMTAYAKLQQLFSEFGHHETLNNY
FT                   FRSPNPQLTSTLFQGIRGSPGLANMQFGRFKILRWRDLTEGYDSGTPDNKPDLPQDPTS
FT                   QMITMWLDGGVRFTFRGSGTEPKVKFYIESCGDSREDAVKAVCDAFLTIREEWVQRFTP
FT                   SMTYSKQLSTSSGDVLNVE"
     atggcacaat caattacctc cttgaccgag caatggctcc aatgggacca ggatcctacg        60
     actcgcgtgg aaatagagca actgcgggac tctaaagcca ccgaggagct ggaaaagcgc       120
     ctgcggaatc gtattgagtt cggaacagct ggtctgcgag gccgcatggc cgcagggttc       180
     tcctgcatga actctttgat agtcatacaa gcctcacagg ggctggccaa gttcattcga       240
     gacaagcgtt ctgagattgc ttctaatggt gtggtcatcg gacacgatgc gcgacacaac       300
     tctgcgaaac tcgccgcact cgctgctaac gctttcatcg cgcaacgtat ccccgtttgg       360
     ttcttcaatg aggaaggccc aacaccgatg gtagcatttg gtgtcaacta ttttggcgct       420
     gctgcaggta ttatggtgac ggcgagccac aatccacccc aggacaatgg ctacaaagtc       480
     tactcaaaca atggcgctca gatcaaccga cctgaggacg gggaaatagc acagtcgatt       540
     caagagaacc tcgagccatg gccgaccgca tgggcggaat tacagccagg cgaattcctg       600
     cgcgcggact cctaccagaa attgctgcct cactacagca gccaagtcgc aaagtacacg       660
     aaatccacgg tgactgattg gcaaccaccg agaccgttcg tttatacacc tctacacggc       720
     gtgggaggtt tggttcttcc aaatctgtgc cgctcacttg gaatcaacga attttcatcc       780
     gttgctgctc aggaaaagcc tgatcccgac ttccccactg tgaagttccc caacccggaa       840
     gaggccggag ccttggatct tgctatcgag actgccgatc aagaaggaaa gaccttgatc       900
     gtcgcaaatg accccgatgc ggaccgcttc gctgtagcgg agaaagtcga tggtaaatgg       960
     catactttga ccggaaacca cctcggtgta cttctggcgt cccatgtctt ggattcgttc      1020
     gatgccagca aaaattggtc ccacatagcg gtgttgacca caacggtgtc aagtggaatg      1080
     ctcggcaaga tggcagctgc aaaggggatt cattttgtgg agaccctgac agggttcaag      1140
     tggatggcta atgttgcccg agacttagaa aaagagggaa agacagttcc ctttgcatac      1200
     gaggaggcac tgggatacat gtttccgtcc gtatgctacg ataaagacgg aatcacagcc      1260
     gcagcggttt tccttgcagc ggaggcgaaa tggagagccc agggaatgac tgcatatgcc      1320
     aagctgcaac aactgttcag cgaatttggc caccacgaga ccttgaataa ctacttccga      1380
     tcaccgaacc cacaactcac ctcaacattg ttccagggca ttcgaggtag tccaggcctc      1440
     gcgaatatgc agtttggtcg attcaagatc ttacgatgga gggatttgac cgagggttat      1500
     gactccggca cccccgataa caagccggac ctaccccaag atcctacaag ccagatgatt      1560
     acgatgtggt tggacggcgg ggtccgcttc actttccgag ggtcggggac ggagcccaag      1620
     gtcaagtttt atatcgagag ttgtggagac tctcgcgaag acgccgtcaa agcagtgtgc      1680
     gatgcattcc tcactattcg ggaagaatgg gtacagcgct ttacaccttc gatgacatac      1740
     agcaagcagc tttctacatc atctggtgat gttctgaacg tcgaataa                   1788
//

If you have problems or comments...

PBIL Back to PBIL home page