(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE443

PENCW_16.PE443       Location/Qualifiers
FT   CDS_pept        complement(1006244..1007050)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000234813" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19824906"
FT                   /orf_name="Pc20g04430"
FT                   /product="Pc20g04430 protein"
FT                   /function="ATP binding"
FT                   /function="protein kinase activity"
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="CAP85772.1"
FT                   /db_xref="GO:0004672"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="UniParc:UPI000183167F"
FT                   /db_xref="UniProtKB/TrEMBL:B6HDR9"
FT                   /transl_table=1
FT                   /translation="MYILEYSEDFGGPEDDFAFQKTIIVYEMSGSIYRAYSRKRYATKE
FT                   DIQFGDMYSTNKIQGALVFPEFSDKFTKAEKSPDCSTWYLKKPSLSPYSPQYPALIRET
FT                   WIEEVKTCELLKKNPHPNIAEYHGCAVVDGGSIRGIYFTKYDETLMARVNTARRNKIDF
FT                   AYERQEADREEIDRWVEGVARGLKHLHGLGIVHNDINPCNIMFQGDTPVIIDFDSARPR
FT                   GHDLSLVKRTHGWHDGKTKVALPMNDIAALLEIQSWLLGEVDQFQF"
     atgtacattc tcgaatattc cgaagatttt ggtggtccag aagatgactt cgcattccaa        60
     aagaccatca tagtctacga aatgtccggc tcgatctaca gagcatactc ccgaaagcga       120
     tatgcaacaa aagaagacat tcagtttggc gacatgtata gtacaaacaa aattcaaggc       180
     gccctcgttt tcccagagtt ttcggacaaa ttcacgaagg ctgaaaagtc cccggactgt       240
     tcaacctggt atctcaaaaa gccaagcctt tccccctaca gtccccaata cccagccttg       300
     atcagagaaa cttggatcga agaggtgaaa acctgcgaac tcctgaagaa aaacccgcac       360
     ccgaatatcg ccgaatacca cggttgcgcc gtcgttgacg gtggctccat caggggcatc       420
     tatttcacaa agtacgatga aacgcttatg gccagagtga acactgccag acgcaataag       480
     atagactttg catatgagag gcaagaggct gaccgagagg agatcgaccg ttgggtggag       540
     ggagtcgcac ggggcctgaa acatctccat gggttgggga tcgtccacaa tgatatcaac       600
     ccgtgcaaca tcatgttcca aggcgacacc cctgttatta tcgattttga ctccgctcgg       660
     cctcgtggcc atgatttgag cctggttaaa cgcacgcatg ggtggcatga tgggaagact       720
     aaggtggctt tgccgatgaa tgacatcgct gcgctgctgg aaatacagtc atggcttttg       780
     ggggaggttg accagtttca attttga                                           807
//

If you have problems or comments...

PBIL Back to PBIL home page