(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE444

PENCW_16.PE444       Location/Qualifiers
FT   CDS_pept        join(1007315..1007544,1007604..1008128,1008385..1008475)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15949954"
FT                   /orf_name="Pc20g04440"
FT                   /product="Putative uncharacterized protein Pc20g04440 "
FT                   /protein_id="CAP85773.1"
FT                   /db_xref="UniParc:UPI0001831680"
FT                   /db_xref="UniProtKB/TrEMBL:B6HDS0"
FT                   /transl_table=1
FT                   /translation="MHRIYREPKAKRDILLPHHHTSRQEADRYGHRNMCHVQQDTPCLS
FT                   ASPHLRQPQSTKETVHCFFCPHFKGHEQGLNMNSESDTRAHHKTFYHHRHERQPIHLPP
FT                   RSRSPDSSEDTQCRHNAGHYPAQEIHSNERRNNQFPVKHFYPETSNDPFDRIHRHAASP
FT                   ERSDSSRATDSSRATDSSRATGYKSHEEGCGSSIKAVRFKEDDKMPEHAKTHHPNCPLY
FT                   HAPSPLEDRHDSHCNPRPNQSQSRELRIFRWVIPQLHKNECTPYGYTRLKLPLDPRALV
FT                   "
     atgcatcgta tatatcgaga gcccaaagcg aaaagggata ttcttctccc acaccatcac        60
     acatcaagac aagaggctga ccgttatggc catcgtaaca tgtgtcacgt ccagcaagac       120
     acgccatgtt taagtgccag ccctcacctc cgtcaaccac aaagtaccaa ggagacggtt       180
     cattgtttct tttgtcctca tttcaaaggt cacgaacagg gcctcaatat gaacagcgaa       240
     tccgacaccc gtgctcacca caagaccttc taccatcatc gccatgaacg tcagcctatc       300
     caccttccac cccgatctcg atctcccgat tcgagtgaag atacacaatg tcgccacaac       360
     gccggccatt atcctgctca agaaatccac tccaatgagc gacgaaacaa ccagtttcca       420
     gtcaagcact tctacccaga aacctcaaat gacccattcg accgcatcca ccgccacgct       480
     gcatcaccag aacgaagcga ttcgtctcgt gctaccgatt cgtctcgtgc taccgattcg       540
     tctcgtgcta ccgggtataa gtcacacgag gaagggtgcg gtagcagcat aaaagccgtt       600
     agattcaaag aggatgacaa gatgcctgaa catgccaaga cccaccatcc aaattgtcct       660
     ctgtatcatg ctccgtcccc tctggaggat cggcacgatt ctcattgcaa tccccggccg       720
     aaccagagcc aatctcgaga attgcggatt ttcaggtggg ttatccctca attacataaa       780
     aatgaatgca ctccgtacgg atacaccaga ctgaaattac cgctagatcc ccgtgctctc       840
     gtatag                                                                  846
//

If you have problems or comments...

PBIL Back to PBIL home page